KEGG   Ramlibacter tataouinensis: Rta_31460Help
Entry
Rta_31460         CDS       T01544                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rta  Ramlibacter tataouinensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rta_31460 (galU)
   00052 Galactose metabolism
    Rta_31460 (galU)
   00500 Starch and sucrose metabolism
    Rta_31460 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Rta_31460 (galU)
Enzymes [BR:rta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rta_31460 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3355205..3356053
Genome map
AA seq 282 aa AA seqDB search
MAGLGTRFLPATKAQPKEMLPIVDKPLIQYAVEEAYDAGIRHMVFVNGRNKRAIEDHFDT
AYELETELEAAGKNDLLALVNSIKPDDMHCSYVRQSRALGLGHAVLCAQPLVGEEAFAVL
LADDLMTGPDGGPSVLKQMVQVFDQTQASVLAVQEVPRDHVKRYGIVAGEASGERLIRVR
QMVEKPAPEVAPSRLGVAGRYVLTPSVFDQIRQQPRGTGNEIQLTDGIARLIATEGVYAY
AYQGKRYDCGSKQGFLEATVELALKHPEVGPGFQEYIKTTFC
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcctgggaacgcgattcctcccggccaccaaggcgcagcccaaggagatgctg
cccatcgtcgacaagcctttgatccagtacgcagtcgaggaagcctacgacgccggcatc
cgccacatggtgttcgtcaacggccgcaacaagcgggccatcgaggaccatttcgatacc
gcctacgagctggagaccgaactcgaggccgccggcaagaacgacctgctggcgctggtg
aattccatcaagcccgatgacatgcactgctcctacgtgcgccagtcccgtgcgctgggc
ctgggacatgccgtgctgtgcgcccagccgctggtgggcgaagaggcattcgccgtgctg
ctggccgacgacctcatgaccggcccggacggcggcccgtcggtgctcaaacagatggtc
caggtgttcgatcagacccaggcctccgtgctcgccgtccaggaagtgccgcgcgatcac
gtcaagcgctacggcatcgtcgccggcgaagccagcggcgaacgcctgatccgggtgcgg
cagatggtcgagaagcccgcccccgaggtggcgccttcgcgcctgggggtggccggccgc
tacgtcctgacccccagcgtgttcgaccagatccgccagcagccccgcggcacgggcaac
gagatccagctgaccgacggcatcgcgcggctgatcgccaccgagggcgtctacgcctat
gcctaccagggcaagcgctacgactgcggcagcaagcagggcttcctggaggcgacggtg
gagctggcgctcaagcaccccgaggtgggccccggcttccaggaatacatcaagaccacc
ttctgctga

DBGET integrated database retrieval system