KEGG   Ramlibacter tataouinensis: Rta_33100Help
Entry
Rta_33100         CDS       T01544                                 

Definition
lysozyme, Glycoside Hydrolase Family 24
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rta  Ramlibacter tataouinensis
Brite
Enzymes [BR:rta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Rta_33100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3524123..3524566)
Genome map
AA seq 147 aa AA seqDB search
MRTELMRQLRGDEGVEPCAYQDSLGYWTIGTGRLVDRRRPGAGLRPVEMDFMLQNDIDDR
INALGKRLPWFQDLDDARKGVLLNMSFQLGVDGLLGFHATLALLQRGDYEAAANNMLRSK
WARQTPARALRLSEQVRTGVWQYAPGA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccgaactgatgcgccagctgcgcggcgacgagggcgtggagccctgcgcctac
caggacagcctgggctactggaccatcggcaccggccgcctggtggaccggcgccggccc
ggcgcgggcctgcggcccgtcgagatggacttcatgctccagaacgacatcgacgaccgc
atcaacgcgctgggcaagcggctgccgtggttccaggatctggacgacgcgcgcaagggc
gtgctgctgaacatgagcttccagctcggggtggatggcctgctggggttccacgccacg
ctggccctgctgcagcgcggcgactacgaggcggcggccaacaacatgctgcgcagcaag
tgggccaggcagacgccggcgcgcgcgctgcgcctgtccgagcaggtgcgcaccggcgtc
tggcagtacgccccgggagcctga

DBGET integrated database retrieval system