KEGG   Ramlibacter tataouinensis: Rta_34080Help
Entry
Rta_34080         CDS       T01544                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rta  Ramlibacter tataouinensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rta_34080 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rta_34080 (pyrB)
Enzymes [BR:rta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rta_34080 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3620621..3621583)
Genome map
AA seq 320 aa AA seqDB search
MLARRNPQLNKNGELIHLLSVEGLPREIMTHILDTASSFVSVNDREVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAATRLSADVINLDIARSSAAKGESLLDTIANLSAMAADLFVVRHS
ESGAPYLIARHVAPHVHVINAGDGRHAHPTQGLLDMYTIRHYKRDFSNLTVAIVGDVLHS
RVARSDIHALTTLGCAEVRVVGPKTLVPGDMASMGVRVFHNLEEGIRGCDVVIMLRLQNE
RMSGALLPSSQEFFKSFGLTPEKLRLAKPDAIVMHPGPINRGVEIDSAVVDGKQSVILPQ
VTFGIAVRMAVMSIVAGNEA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgcgccgcaacccgcaactgaacaagaacggcgagctgatccacctgctgtcg
gtggagggcctgccgcgcgagatcatgacccacatcctggacaccgcctccagtttcgtc
agcgtcaacgaccgcgaggtcaagaaggtgccgctgctgcgcggcaagagcgtgttcaac
ctgttcttcgagaacagcacccgcacccgcaccaccttcgagatcgcggccacccggctg
tcggccgacgtgatcaacctggacatcgcgcgctcctcggcggccaagggcgagtcgctg
ctggacaccatcgccaacctgtcggcgatggcggccgacctgttcgtggtgcggcacagc
gagtccggcgcgccctacctgatcgcgcggcacgtcgcgccgcacgtgcacgtgatcaac
gccggcgacggccgccacgcgcacccgacccagggcctgctggacatgtacaccatccgg
cactacaagcgcgacttctccaacctcacggtcgccatcgtgggcgacgtgctgcactcg
cgcgtggcgcgctcggacatccacgcgctgaccacgctgggctgcgccgaggtgcgggtg
gtcggccccaagaccctggtgcccggcgacatggccagcatgggcgtgcgcgtgttccac
aacctggaggagggcatccgcggctgcgacgtggtgatcatgctcagactgcagaacgag
cgcatgagcggggcgctgctgccttcctcgcaggagttcttcaagagcttcggcctgacg
cccgagaagctgcggctggccaagcccgacgccatcgtcatgcaccccggccccatcaac
cgcggcgtggagatcgactcggcggtggtcgacggcaagcagagcgtgatcctgccgcag
gtgaccttcggcatcgccgtgcgcatggccgtgatgagcatcgtggccggcaacgaggcc
tga

DBGET integrated database retrieval system