KEGG   Ramlibacter tataouinensis: Rta_34310Help
Entry
Rta_34310         CDS       T01544                                 

Gene name
dsbC
Definition
Thiol:disulfide interchange protein dsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rta  Ramlibacter tataouinensis
Brite
Enzymes [BR:rta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Rta_34310 (dsbC)
Secretion system [BR:rta02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Rta_34310 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3650328..3651041
Genome map
AA seq 237 aa AA seqDB search
MNPFKRGLLAALCAASLASAAVAQEATIRKNLAERIPQLAKIDEISKTPMPGLYEVRVGT
DVVYTDAEGNFLLQGNLFDTRQKLNLTEERMEKLLAVDFDSLPVKDAFTVVRGNGKRKMA
IFQDPNCSFCKRFERDFQKVDNVTVYMFLYPILSQDSADKSRNIWCAKDKARAWSDWMVR
DQVPAAASCDTAALQRNIEFGKKHKITGTPTLLFADGSRVPGAIGAQQVEKYLAGAK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaacccattcaagcgcgggctgctggcagccctgtgtgccgccagcctcgccagcgcc
gccgtggcgcaggaggcgacgatccgcaagaacctggccgagcgcatcccgcagctggcc
aagatcgacgagatcagcaagacgcccatgcccggcctgtacgaggtgcgcgtgggcacc
gacgtggtctacaccgacgccgagggcaacttcctgctgcagggcaacctgttcgatacg
cgccagaagctcaacctcaccgaggagcggatggagaagctgctggcggtggacttcgac
agcctgccggtcaaggatgcgttcaccgtggtgcggggcaacggcaagcgcaagatggcc
atcttccaggaccccaactgctcgttctgcaagcgcttcgagcgggacttccagaaggtg
gacaacgtcaccgtctacatgttcctctaccccatcctgagccaggactcggccgacaag
tcgcgcaacatctggtgcgctaaggacaaggcccgcgcctggagcgactggatggtgcgc
gaccaggtgccggccgccgccagctgcgacaccgcggcgctgcagcgcaacatcgagttc
ggcaagaagcacaagatcaccgggacgcccaccctgctgttcgcggacggctcccgcgtg
ccgggtgccatcggcgcccagcaggtcgagaagtacctggccggcgccaagtga

DBGET integrated database retrieval system