KEGG   Ramlibacter tataouinensis: Rta_35790Help
Entry
Rta_35790         CDS       T01544                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rta  Ramlibacter tataouinensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rta01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rta00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3820916..3821707)
Genome map
AA seq 263 aa AA seqDB search
MPDILTKIVAVKHEEIAQAKKKVSFEAMRADAESRVLTRDFEGALRRRIAAGRSAVIAEV
KKASPSKGVLRADFIPADIAQSYAEHGAACLSVLTDRQFFQGRPDYLKQARASCDLPVLR
KDFMVDPYQVYESRAMGADCILLIAACLQDAQMAELEALARGLDMAVLVEVHDGAELERA
LRLKTPLVGINNRNLRSFEVSLETTLDLLPQVPADRLLVTESGILAQADVRRMRAAGVHA
FLVGEAFMRAPEPGEALAELFND
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacatcctcacgaaaatcgtcgcggtcaagcacgaggagatcgcgcaggcgaag
aagaaggtctcgttcgaggccatgcgcgccgacgccgagagccgcgtgctcacgcgcgac
ttcgaaggcgcgctgcgccggcgcatcgcggccggccgcagcgccgtgatcgccgaggtc
aagaaggccagccccagcaagggcgtgctgcgcgccgacttcatccccgccgacatcgcg
cagagctatgccgagcatggggcggcctgcctgtcggtgctgaccgaccgccagttcttc
caggggcggccggactacctgaagcaggcgcgcgcctcctgcgacctgccggtgctgcgc
aaggacttcatggtcgatccctaccaggtgtacgagtcgcgcgccatgggcgccgactgc
atcctgctgatcgccgcctgcctgcaggacgcgcagatggccgagctggaggccctcgcc
cgcggcctggacatggccgtgctggtcgaggtgcacgacggcgccgagctggagcgggcg
ctgcgcctgaagacgcccctggtcggcatcaacaaccgcaacctgcgcagcttcgaggtc
agcctggagaccacgctggacctgctgccgcaggtgccggccgaccggctgctggtgacc
gagtcgggcatcctggcccaggccgacgtgcgcaggatgcgcgctgccggcgtgcatgcc
ttcctggtcggggaggctttcatgcgcgcacccgagcccggcgaggccctggccgaactg
ttcaacgattga

DBGET integrated database retrieval system