KEGG   Ramlibacter tataouinensis: Rta_37160Help
Entry
Rta_37160         CDS       T01544                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rta00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rta00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3957997..3958587
Genome map
AA seq 196 aa AA seqDB search
MKPLFLTLAGALAATLAASAAGQTPAAAGSAPAAAASCPATLNHTFPRLQDEKPQSLCQY
TGKVLLVVNTASYCGFTPQYQGLEALYGKYRDRGLVVLGFPSNDFAQEKGSNKEIADFCE
NTFGVKFPMFAASSVRGKDANPLFRQLAQQAGRQPLWNFHKYLVGRDGKVIANYTSMTAP
NDRSLVAEIEKSLSAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccattgttcctcacgctggcgggcgcgctggccgccacgctggcggcttcggcc
gccggccagacgcctgctgccgcaggcagcgcccctgccgccgcggccagctgcccggcc
acgctgaaccacacctttccccggctgcaggacgagaagccccagtcgctgtgccagtac
accggcaaggtgctgctggtggtgaacaccgccagctactgcggcttcaccccccagtac
cagggcctggaagcgctgtacggcaagtacagggatcgcggcctggtggtactgggcttt
ccctccaacgacttcgcgcaggagaagggaagcaataaggagatcgccgacttttgcgag
aacactttcggcgtgaagtttccgatgttcgctgcctccagcgtgcgcggcaaggacgcc
aacccgctgttccgccagctggcccagcaggccggccgccagccgctttggaacttccac
aagtacctggtgggccgcgacggcaaggtgatcgccaactacaccagcatgaccgcaccg
aacgatcgctcgctggtcgcggaaatcgaaaaaagcctgtcagcacgctga

DBGET integrated database retrieval system