KEGG   Ramlibacter tataouinensis: Rta_37860Help
Entry
Rta_37860         CDS       T01544                                 

Definition
guanyl-specific ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rta  Ramlibacter tataouinensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4032600..4032995
Genome map
AA seq 131 aa AA seqDB search
MARMAAIKLALTSFLLAAALGGPAQARTPADPAPGGSAAISLAELPRQGRDTYELIRQGG
PFPYDKDGTVFGNRERLLPLNKRGYYREYTVKTPGARNRGARRIVCGGPVRAPSACYYTA
DHYASFRKIVE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcatggcagccatcaagcttgcactcaccagcttcttgttggcagccgcgctc
ggtggtccggcgcaagccaggaccccggcggacccggcgcccggcggttcggcggcgatt
tcgctggccgagctgccacggcagggtcgtgacacctacgagctgatccgccagggcgga
ccgttcccgtatgacaaggacggcacggttttcggcaaccgggaaaggctgctgccgctg
aacaagcgcggctactaccgggagtacaccgtcaagacgccgggagcgcgcaaccgtggc
gcccggcgcatcgtatgcggcggtccggttcgggcacccagtgcctgctactacaccgcc
gaccactacgccagttttcgcaagattgtggagtga

DBGET integrated database retrieval system