KEGG   Ramlibacter tataouinensis: Rta_37860Help
Entry
Rta_37860         CDS       T01544                                 

Definition
guanyl-specific ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rta  Ramlibacter tataouinensis
Brite
Enzymes [BR:rta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Rta_37860
Transfer RNA biogenesis [BR:rta03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Rta_37860
 Prokaryotic Type
    Rta_37860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4032600..4032995
Genome map
AA seq 131 aa AA seqDB search
MARMAAIKLALTSFLLAAALGGPAQARTPADPAPGGSAAISLAELPRQGRDTYELIRQGG
PFPYDKDGTVFGNRERLLPLNKRGYYREYTVKTPGARNRGARRIVCGGPVRAPSACYYTA
DHYASFRKIVE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcatggcagccatcaagcttgcactcaccagcttcttgttggcagccgcgctc
ggtggtccggcgcaagccaggaccccggcggacccggcgcccggcggttcggcggcgatt
tcgctggccgagctgccacggcagggtcgtgacacctacgagctgatccgccagggcgga
ccgttcccgtatgacaaggacggcacggttttcggcaaccgggaaaggctgctgccgctg
aacaagcgcggctactaccgggagtacaccgtcaagacgccgggagcgcgcaaccgtggc
gcccggcgcatcgtatgcggcggtccggttcgggcacccagtgcctgctactacaccgcc
gaccactacgccagttttcgcaagattgtggagtga

DBGET integrated database retrieval system