KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_00575Help
Entry
RTB9991CWPP_00575 CDS       T01810                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
rtb00020  Citrate cycle (TCA cycle)
rtb00190  Oxidative phosphorylation
rtb00650  Butanoate metabolism
rtb01100  Metabolic pathways
rtb01110  Biosynthesis of secondary metabolites
rtb01120  Microbial metabolism in diverse environments
rtb01130  Biosynthesis of antibiotics
rtb01200  Carbon metabolism
Module
rtb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rtb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTB9991CWPP_00575
   00650 Butanoate metabolism
    RTB9991CWPP_00575
  Energy metabolism
   00190 Oxidative phosphorylation
    RTB9991CWPP_00575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS PAP2
Motif
Other DBs
NCBI-ProteinID: AFE54820
Position
150887..151264
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVAFIVA
IFYSE
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaatctaaaagtagcagttcttctaaaagt
ggtgcgcatcattggttattgcaaagagtaactggtgtggtattagctttatgttctttt
tggttaatatattttatgtttaccaacaaaaataatgatataaatattattatgtgggag
tttaaaaaaccttttaatatagtaattttattaattacggttactatttcattgtatcat
tcagtacttgggatgcgtgtagtaattgaggactatataaattgtcacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtagcttttatagtagcg
atattttatagtgaataa

DBGET integrated database retrieval system