KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_00575Help
Entry
RTB9991CWPP_00575 CDS       T01810                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RTB9991CWPP_00575
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTB9991CWPP_00575
   00650 Butanoate metabolism
    RTB9991CWPP_00575
  Energy metabolism
   00190 Oxidative phosphorylation
    RTB9991CWPP_00575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150887..151264
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVAFIVA
IFYSE
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaatctaaaagtagcagttcttctaaaagt
ggtgcgcatcattggttattgcaaagagtaactggtgtggtattagctttatgttctttt
tggttaatatattttatgtttaccaacaaaaataatgatataaatattattatgtgggag
tttaaaaaaccttttaatatagtaattttattaattacggttactatttcattgtatcat
tcagtacttgggatgcgtgtagtaattgaggactatataaattgtcacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtagcttttatagtagcg
atattttatagtgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system