KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_00830Help
Entry
RTB9991CWPP_00830 CDS       T01810                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
rtb00020  Citrate cycle (TCA cycle)
rtb00310  Lysine degradation
rtb01100  Metabolic pathways
rtb01110  Biosynthesis of secondary metabolites
rtb01120  Microbial metabolism in diverse environments
rtb01130  Biosynthesis of antibiotics
rtb01200  Carbon metabolism
Module
rtb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rtb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTB9991CWPP_00830
  Amino acid metabolism
   00310 Lysine degradation
    RTB9991CWPP_00830
Enzymes [BR:rtb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RTB9991CWPP_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFE54871
Position
complement(213360..214556)
Genome map
AA seq 398 aa AA seqDB search
MSIKIIIPSLGESVTEATIAKWYKKLGDAVKTDELLLEIETDKVTLEVNAPCNGTIGKIS
KTDGANVTVGEEVGEINEIADTDTAWINNKKQEVSQHTSEQLVDKPAMASNILAPSVQKL
VTENKLDPNNIKGTGRGGRITKYDVLETINTTPITIETHAINKTNEERTQRVRMSRLRKT
IAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALK
LIPSINAEIDGDDLLYKNYYDIGVAVGTEQGLVVPVIRDADKMSFADIEQAIGNLAKKAR
EGKLSISDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPM
MYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLLNL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaaattataataccgtcgcttggggagtcagtaacggaagcaactattgct
aaatggtataagaaattaggtgatgcagttaaaactgatgagttattattggaaatcgaa
actgacaaagtgacgttagaagttaatgctccttgcaatggtactatagggaaaatatca
aaaactgacggtgcaaatgtcacagttggcgaagaagtaggtgaaatcaatgaaattgca
gatacagatactgcttggattaataataaaaagcaagaagtttcacaacacacttcagaa
cagcttgtagataaacctgccatggctagtaatattcttgctccttcagtacaaaaatta
gtgaccgaaaacaagcttgatccaaataatattaaaggaactggtagaggtggtagaatt
acgaaatatgatgtactggaaaccataaacactacacctattactattgagactcatgca
ataaataaaactaatgaagaaagaacacaacgcgtgcgtatgtcacgcttgcgtaaaact
attgcacagcgtttaaaagattcacaaaatactgcagctattttgactacttttaacgaa
atcgatatgtcaaaagttattgctttgcgtaatcaatataaagaagagtttgagaaaaag
catactgtaaaacttggatttatgtcattttttgttaaagcaacaattgaagctttaaag
ctgattccatcgataaatgcggaaatagatggagatgatttattatataagaactattac
gatataggtgtagcagtaggaacagagcaaggacttgttgtaccagttattagggatgcc
gataaaatgagttttgctgatatagagcaagctataggaaatttagcaaaaaaagctcgt
gagggaaaactttctatatctgatttgtcaggtggtacattttcaatttctaatggagga
gtatatggctcattattatctacaccgattattaatcctcctcaatcaggtattttagga
ttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgtccaatg
atgtatatagctttatcttatgatcatcgtatcattgatggaaaagaaggagtatcattc
ttggtaaaaattaaaaatcttattgagaatcctgagaagttattattaaatttgtag

DBGET integrated database retrieval system