KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_01835Help
Entry
RTB9991CWPP_01835 CDS       T01810                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rtb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RTB9991CWPP_01835 (ruvA)
Enzymes [BR:rtb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RTB9991CWPP_01835 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474988..475590
Genome map
AA seq 200 aa AA seqDB search
MIGKLSGKIDSQCDDYVIIDVNGVGYLVYASGTTLAKLVEGRFYKLFIETHVREEHIHLY
GFLTLEEKNFFNLLQSVNGIGTKMALSILSNLTPTDIKIAINNDDKNIFKAISGVGDKLT
ERIMLELKGKIAKIFSSSAIIKDSSNISSVEINEVIKALVNLGFTRFEAQNTVQGIITQN
TKISIDELIKTALKNRNSSF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaattaagtggtaagattgattcacaatgtgatgattatgtaataatcgac
gtaaacggggtaggttatcttgtgtatgcttcaggtacgaccttagcgaaacttgttgaa
ggcaggttttataaactattcatcgaaacccatgttagagaggaacatatccatctttac
ggttttttaactctagaagagaaaaatttttttaatttgctgcaatctgttaatggtatt
ggtacaaaaatggctttgtctattttatcaaatcttactcctacggatattaaaatcgct
ataaataatgatgataaaaatatatttaaagcaatatctggagttggtgataagcttact
gaacgtataatgttagaactgaaaggtaaaatagcaaaaatattcagcagctctgctatt
attaaagatagttctaatatttcatctgttgaaattaatgaagtaataaaagcattagta
aatttaggattcactcgatttgaagctcaaaacactgttcaaggtataatcacacaaaac
actaaaatctcgattgatgaactaatcaaaacagcattaaaaaatcgtaattctagtttt
taa

DBGET integrated database retrieval system