KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_02075Help
Entry
RTB9991CWPP_02075 CDS       T01810                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
rtb00020  Citrate cycle (TCA cycle)
rtb00640  Propanoate metabolism
rtb01100  Metabolic pathways
rtb01110  Biosynthesis of secondary metabolites
rtb01120  Microbial metabolism in diverse environments
rtb01130  Biosynthesis of antibiotics
rtb01200  Carbon metabolism
Module
rtb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rtb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTB9991CWPP_02075 (sucC)
   00640 Propanoate metabolism
    RTB9991CWPP_02075 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RTB9991CWPP_02075 (sucC)
Enzymes [BR:rtb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RTB9991CWPP_02075 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp SpoIISA_toxin
Motif
Other DBs
NCBI-ProteinID: AFE55118
Position
complement(531494..532654)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINEAIDKLNTKVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNHLYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEAVAEKMPEKIIKFAVDPATGLQDFHMRGIAYGLGFKDSQAKQMKEI
VKSVYNAFIETDATQIEINPLIINSYKNLLALDAKITFDDNGLFKHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAARDIGITVPLVVRLAGTNVEKGKEI
LSNSNLKIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatatggcgtacctacgtcc
accggattagttgttactaaaactgaaaagattaatgaagctatagataaattaaacacg
aaagtatatgtagttaaagcacaaatccatgcaggaggtagaggtaaagcaggcggagtt
aaagtcgtaaaaagtaaagaagaagccaaaaaagtggctcatgatatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaatcatctttatatcgaatca
ggctgtgatattttaaaagaatattattttagtatcgtatttgatagatcggctagctgt
attactttcatagcttctactgaaggtggtgttgatattgaagcagtagcagaaaaaatg
ccggaaaaaattattaaatttgcagttgatcctgcaactggtttacaagattttcatatg
agaggcatagcgtatgggttaggattcaaggatagccaagctaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaactgatgcaacacaaattgaaattaacccg
ttaattataaatagctataaaaacttattggccttagatgcaaaaatcacttttgatgat
aatggcttatttaaacatccaaatattactgcaatgcgtgatcatgatgaagaagatccg
ctagaaacgcgagcagcgaatgcaggacttagttatgtaaaaatggacggtaatattggt
tgtatggttaatggtgctggtcttgcaatggcgactatggatattattaagctttacggt
gcttcacctgcaaatttcttagatgtaggcggtggcgcagaccgtgagcgtgtaaaagaa
gcattaaaaataattctatcagataaagaagtaaaaggaattttagttaatatttttggc
ggtattatgcgttgtgatattatagcagaaggaattattgccgctgcaagagacataggt
ataacagtaccattagtagttcgcttagcaggtacaaacgttgaaaaaggtaaagaaatt
ttgtcaaattccaatttaaaaataataccagcacatgatttagcagatgcagcaaataag
atagttgaagctatacggtaa

DBGET integrated database retrieval system