KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_02100Help
Entry
RTB9991CWPP_02100 CDS       T01810                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rtb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RTB9991CWPP_02100 (recR)
DNA repair and recombination proteins [BR:rtb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RTB9991CWPP_02100 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535388..535987
Genome map
AA seq 199 aa AA seqDB search
MNKTNDIDQLIYLFSKLPGLGIRSARRIVLYLLQDKDVRLKSLINHLIELDKKIVKCEIC
GNMDTKNICHICSSEHRDKSTIAIVETVAELCAMERSGNFKGLYHVLGHNLSAASRQNPR
ILRLPELLKRCFVENIKEVIIATNSTLEGQTTAYFIIEYLKEHPAKISRLASGIPIGGEL
DYLDEGTLSAAINLRQPCE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaaatgatatagaccagttaatttatcttttttcaaaattacctggtctt
ggtattagatcagcaaggcgtatagtactttatctattgcaagataaagatgtaaggtta
aaaagcctcattaatcaccttatagagcttgataagaaaatagtaaaatgcgagatttgt
ggtaatatggatacgaaaaatatttgccatatttgttcttctgaacatagagataagtcg
actattgctattgttgaaactgtagctgaattatgtgcaatggagcgtagcggtaatttt
aaaggtttatatcacgtactcggtcataatttatctgcagctagtagacagaaccctcgc
atactccgtttacctgaattacttaaaaggtgttttgtagaaaatattaaagaagttatt
attgctactaattctactttagaaggtcaaactactgcttattttattatagaatattta
aaagagcatcctgctaaaatttctcgacttgcaagcggtatacctattggaggtgaactt
gactatttagatgaagggaccttatctgctgctattaacctacgtcaaccttgcgaataa

DBGET integrated database retrieval system