KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_02505Help
Entry
RTB9991CWPP_02505 CDS       T01810                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
rtb00010  Glycolysis / Gluconeogenesis
rtb00020  Citrate cycle (TCA cycle)
rtb00620  Pyruvate metabolism
rtb01100  Metabolic pathways
rtb01110  Biosynthesis of secondary metabolites
rtb01120  Microbial metabolism in diverse environments
rtb01130  Biosynthesis of antibiotics
rtb01200  Carbon metabolism
Module
rtb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rtb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RTB9991CWPP_02505
   00020 Citrate cycle (TCA cycle)
    RTB9991CWPP_02505
   00620 Pyruvate metabolism
    RTB9991CWPP_02505
Enzymes [BR:rtb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RTB9991CWPP_02505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFE55204
Position
complement(659297..660511)
Genome map
AA seq 404 aa AA seqDB search
MPIKILMPALSPTMKDGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKII
IPQNSQNVPVNSLIAVLSEEGESTADIDAFIAKNNSVSLSLKTDTTLKKANESITNVEVV
KHDLSKIFASPLAKRLAKIRNIRLESVQGSGPHGRIVKQDILSYSPSTAYNRDTEEYRSV
PNNNIRQIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKLTKISVNDFII
LAVAKALQEVPNANASWAEDAIRYYNNVDISVAVAIENGIVTPIIKDANKKNIIELSHEM
KILIKKAKDNKLTPVEFQGGGFTISNLGMYGIKNFNAIINTPQSCIMGVGASTKRAIVKN
DQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIEHPVLMLI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttgtctccaactatgaaggatggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcccggggaagtaattgctgaaattgaa
actgataaagcaacaatggaagtagaatcagtagatgaaggtatacttgctaaaataatt
attccacaaaatagtcaaaatgtacctgtgaactctttaattgcagtgttaagtgaagaa
ggagaaagtacagcagatattgatgcgtttattgcaaaaaataatagtgtatcactatcg
ctcaaaacagatactactcttaagaaagcaaatgagagcataactaatgtagaggttgta
aaacatgatcttagtaaaatatttgcctcaccacttgcaaaaaggcttgcaaaaattaga
aatattagacttgagagtgtgcaaggtagtggaccgcacggtagaatagtcaaacaagat
atattatcatattctcctagcactgcttataacagagatactgaagaatatcgttcagta
ccaaataataatatccgacagattatagctaagcgtttgcttgaatcgaagcaaacagtt
ccacatttttatttatctatagaatgtaatgttgataaattattagatataagggaagac
attaataaatctttttctgaagataaattaacaaagatatcagttaatgattttatcatt
ttagcggtagctaaagctttacaagaagtgccaaatgctaatgctagctgggcagaagat
gcgattagatattacaataatgtcgatatttcagtggcggtagcaatcgagaatggtatt
gttacaccgataattaaagatgctaataaaaaaaatattatagaattatcgcacgaaatg
aaaatattaatcaagaaagcaaaagataataaattaacccctgtagaatttcagggtgga
ggatttacaatttctaatctcggaatgtacggtattaagaattttaatgctatcattaac
acaccgcaaagttgtataatgggtgttggagctagtacaaaacgtgctatagttaaaaat
gatcaaataattatagcaacaattatggacgtcactctttctgctgatcaccgagtaata
gatggagcagttagtgctgagtttttggcatcatttaaaaggtttatagagcatcctgtt
ttgatgctgatataa

DBGET integrated database retrieval system