KEGG   Ruminococcus torques L2-14: RTO_00220Help
Entry
RTO_00220         CDS       T02606                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rto  Ruminococcus torques L2-14
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rto00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17073..18587
Genome map
AA seq 504 aa AA seqDB search
MSERAAGILMPISSLPSEYGIGCFSKSAYEFVDWLKGAGQSYWQILPLGPTSYGDSPYQS
FSTFAGNPYFISLDELIEEGVLTRAECEKVNWGKAKGSIDYEKIYKGRYPLLRKAYERSK
ISENPEYQKFVNENSWWLSDYALFMAVKGRFDNVEWTKWAENIRLRWKWAMDYYREELYY
DIEFQQYMQFKFHEQWMKLKAYANENGIKIIGDIPIYVAMDSADTWAHPELFQLDEENVP
TAVAGCPPDGFSATGQLWGNPLYRWDYHRETGYSWWISRLHYVFQMYDVVRIDHFRGFDE
YFSIPYGAENAIGGHWEKGPGIDLFRKVEQALGWKQVIAEDLGYVTDSVRELVRESGFPG
MKVLEFAFDSRDSGCANDYLPHNYPVNSVAYTGTHDNETIVGWWSSITKEEQKLARDYMC
DQYTPESELYKSLISLIMRSSAKLCVIPMQDYLGLGNNCRINTPSTVGKNWKWRVNTRQL
SLKLQKEIQEMTLRYGRMNWETVE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagagcagcaggtattttaatgccgatcagtagtttgccgtcagagtacgga
attggttgtttttcaaaaagtgcgtatgaatttgtagattggctcaaaggagcaggccag
agttattggcagattctcccgcttggaccgaccagttatggagattctccatatcagtcc
ttttctacatttgcaggaaatccgtactttatcagtcttgatgaactgatcgaggaaggt
gttctgacacgtgcagaatgtgagaaagtaaactggggaaaagcaaagggttctattgat
tacgagaagatttataaaggacgctatccactgcttcgaaaggcttatgagagaagtaag
atcagtgagaatccggagtatcagaaattcgtgaatgagaatagctggtggctgtcagat
tatgcactgttcatggctgtaaaaggaagatttgacaatgtagagtggacaaaatgggca
gaaaatatccgtctccgttggaaatgggcaatggattattacagagaggaactgtattat
gatattgaattccagcagtacatgcagtttaaattccacgagcaatggatgaaattaaag
gcatatgcaaatgaaaatggaatcaagatcattggagatatcccgatctatgttgcaatg
gacagtgcggatacctgggcgcatccggaactgtttcagttagatgaggaaaatgttccg
acagctgtagccggatgcccgccggatggattctctgcgacaggacagctgtggggaaat
ccgctgtaccgttgggactatcatagagagacaggatattcatggtggatttcaagactg
cattatgtattccagatgtatgatgttgtcagaatcgatcatttccgtggatttgatgaa
tacttttcaattccgtatggggcagagaatgcgatcggaggacattgggagaaaggtcct
ggaatcgatctgttccgcaaagtggaacaggcacttggatggaagcaggttattgccgaa
gatcttggttatgtgacagattctgttcgtgagctggtccgcgagagtggttttccggga
atgaaggttctggaatttgcatttgattcccgtgactcaggttgtgcgaatgattatctt
ccacataactacccggtgaatagtgtggcttatacaggaactcatgacaacgagacaatc
gttggatggtggagcagtatcacaaaagaggagcaaaaactggcgagagattacatgtgt
gaccagtacacaccggaaagtgaactgtataaatctctgattagcctgattatgcgaagc
agtgcaaagctgtgtgttattccgatgcaggactatttaggacttggaaataattgtcgt
ataaatactccgtctacggtaggaaagaactggaagtggagagtgaatacaagacagttg
tcattgaaattgcagaaggaaatccaggagatgacacttagatatggaagaatgaactgg
gagacagtcgagtag

DBGET integrated database retrieval system