KEGG   Ruminococcus torques: RTO_02770Help
Entry
RTO_02770         CDS       T02606                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
rto  Ruminococcus torques
Pathway
rto00052  Galactose metabolism
rto00561  Glycerolipid metabolism
rto00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rto00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RTO_02770
  Lipid metabolism
   00561 Glycerolipid metabolism
    RTO_02770
   00600 Sphingolipid metabolism
    RTO_02770
Enzymes [BR:rto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RTO_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2
Motif
Other DBs
NCBI-ProteinID: CBL25056
UniProt: D4M1E4
Position
268093..270336
Genome map
AA seq 747 aa AA seqDB search
MRQIIFHEETKTFHLYNEKISYILCVLENGHLGQLYFGKRLHDKADFSYLVEKCGRPMTS
YIYEWDRTFSLEHIRQEYPVYGTTDYRHPAIELLQENGSRISEFQYESYEIIAGKPKLSG
LPATYTESEEEAQTLRIFLKDALTGAKLALLYTIFDEYSAIARSAYIENAGEKNLHVLNM
MSLSLDLPDKDYEWMQLSGAWSRERYIKNRTLEQGITAIDSMRGNSSHEHNPFLALKRHN
TDENAGEAIGISLVYSGNFRMQAEVDTHDVTRITAGINPEGFDWKLEPGESFQTPEAVLV
YSENGLNGMSQTFQKLYAKRLARGYWRDKARPILNNNWEATYFDFTEDRLVEIARKAKEC
GVELFVLDDGWFGARRNDRAGLGDWVANEELLPNGIKGLSERIEALGLKFGLWFEPEMVN
KDSDLYRAHPDWILQTPGRNTSHGRYQYVLDFARKEVVDHIYGMMAKLLSESKISYIKWD
MNRSITECYSSKLPSDRQGEVFHRYILGVYDLYERLTNEFPEVLFESCASGGGRFDPGML
YYAPQGWTSDDSDAIERLKIQYGTSMCYPLSSMGSHVSVVPNHQVFRNTPLHTRANVAYF
GTFGYELDLNKLTEEEIKEVKEQITFMKEYREVLQFGTFYRLKSPFEGNETVWMVTNEDR
TLAIVGYYRVLNGVNQPYSRVRLQGLNPDMVYENVWNHTENYGDELMNYGLITSDVTAGE
VPGNVTPCTDFESRIYMLKGKKVQEGR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgagacagattatttttcacgaggaaacgaaaactttccatttatacaatgaaaaaatc
agttatatcttatgtgtattagaaaatggacatctgggacaattatattttggaaaacga
cttcatgataaagcagatttttcttatctggttgaaaaatgtggacgcccaatgacatca
tatatatatgaatgggatcgtactttttcattggaacatatccgacaggaatatccggtt
tacggtacgacagattacagacatccggcaattgaattgttgcaggaaaatggcagcaga
atcagtgagttccaatatgaaagctatgagattattgccggaaaaccgaaactctccgga
ttgccggcaacttacacagagtccgaggaggaagcgcagacattgcgcatcttcctgaaa
gacgctttgactggtgcaaaactggcgcttttatatacgatttttgatgaatatagtgca
attgcaagaagtgcttatattgaaaatgccggtgagaaaaatctgcatgtattaaatatg
atgagcttaagcctggatcttccggataaggattatgaatggatgcagttgtccggtgcg
tggtccagagagcgctatataaagaatcgaacattggagcagggcataacagctatcgac
agcatgcgcggaaattcttctcacgaacataatccgttccttgctttaaaacgtcacaac
acagatgaaaatgcaggagaagcaattggaataagccttgtatacagtggaaatttccgt
atgcaggcagaggtagatacacatgatgtgacacgaattacagccgggatcaatccggaa
ggattcgattggaaattagaaccgggagaaagctttcagacaccggaagcagttctggtt
tacagtgaaaatggattaaatggcatgagtcagacgttccagaagttgtatgctaagaga
ctcgcaagagggtactggcgtgataaggcaagaccgattttaaataacaactgggaagca
acttattttgactttacagaagatcgccttgtagagattgcaaggaaagcaaaagaatgt
ggagtagaactgtttgtcttagatgacggatggtttggcgcaagaagaaatgacagagct
ggtcttggtgattgggtggcaaatgaagagcttctgccaaatggcatcaaaggcctgtca
gaaagaattgaagcactaggattaaaattcggtctttggtttgagccggagatggtaaat
aaagactctgatctttatcgagcacatccggactggatcttacagacaccgggaagaaat
acatcacacggcagataccagtatgtactcgattttgcaagaaaagaagtagtagatcat
atttacggaatgatggcaaagttattatcggagtcgaaaatctcatatattaaatgggat
atgaaccgaagcattacagaatgctacagcagcaaacttccttcagacagacagggagaa
gtgttccatcgttatattttaggtgtatatgatctgtatgaacgtttgacaaatgagttt
ccagaagtactatttgaatcctgcgccagcggtggcggaagatttgacccgggaatgctg
tattatgcaccacagggatggacaagtgatgattcggatgcaattgagcgtctaaagatt
cagtatggaacttctatgtgttatccgctcagcagtatgggaagccatgtgtctgttgtt
ccgaatcaccaggtatttcgcaataccccattacatacaagagcgaatgtagcatacttt
ggaacttttggatatgaactggatctcaacaaattgacagaagaagagatcaaagaagta
aaagaacagatcacatttatgaaagaataccgagaagtgttacagtttggaacattttat
cgtttgaaaagtccattcgaaggaaatgagacggtatggatggtgacaaatgaagaccgc
acgcttgcaatcgtaggatactatcgtgttttaaatggagtgaatcagccgtatagccgt
gtcagattacaggggttgaacccggatatggtctatgaaaatgtatggaaccatacagaa
aattacggagatgaattaatgaattatggattgatcacatccgatgtgacagctggtgaa
gtgcctgggaatgtgactccttgtaccgattttgaatctagaatatatatgctgaaaggc
aaaaaagttcaggagggaagatag

DBGET integrated database retrieval system