KEGG   Ruminococcus torques: RTO_09610Help
Entry
RTO_09610         CDS       T02606                                 

Definition
acetaldehyde dehydrogenase/alcohol dehydrogenase AdhE (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
rto  Ruminococcus torques
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rto00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RTO_09610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RTO_09610
   00620 Pyruvate metabolism
    RTO_09610
   00650 Butanoate metabolism
    RTO_09610
  Lipid metabolism
   00071 Fatty acid degradation
    RTO_09610
  Amino acid metabolism
   00350 Tyrosine metabolism
    RTO_09610
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RTO_09610
   00626 Naphthalene degradation
    RTO_09610
Enzymes [BR:rto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RTO_09610
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RTO_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(966059..968698)
Genome map
AA seq 879 aa AA seqDB search
MAKKEAAKTVETKTVNTGFVDNVEALEAKMKEMREAQKIFATFTQEQVDKIFYEAAMAAN
KQRIPLARLAVEETQRGILEDKVIKNHYAAEYIYNAYKDTKTCGVVEEDKAFGIKKIAEP
IGLVAAVIPTTNPTSTAIFKTLICLKTRNAIIISPHPAAKASTIAAAKVVLDAAVKAGAP
EGIIGWIDAPSLELTNTVMRDADIILATGGPGMVKAAYSSGKPALGVGAGNTPVIIDDTA
DVRMAVNSIIHSKTFDNGMICASEQSVTVLESVYEEAKKEFQYRGCYFLKPGEELDKVRK
TIIINGALNSKIPGKSAYEIAQMAGVDVPKNTKILIGEVESVDISEEFAHEKLSPVLGMY
KAKTFDEALEKAAQLVADGGYGHTSSLYVHPAETEKIAKHAAAMKTCRVLINTPSSHGGI
GDLYNFKMAPSLTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRTPEKVYFKKG
SMPVALDELGTVMHKKKAFIVTDSFLYKNGYVKPIEDKLDEMGIQHTCFFEVAPDPTLQC
ARKGVDQMRQFEPDTIIALGGGSAMDAGKIMWIMYEHPEANFEDMAMDFMDIRKRVFTFP
KMGEKAYFVAIPTSSGTGSEVTPFAIITDADTGVKWPIADYALLPNMAIVDVDNMMTQPK
GLTSASGIDVMTHAIEAYVSIMATDYTDGLAMKAVKLVFENLPSAYENGANDPKAREEMA
NASCMAGMAFANAFLGVNHSMAHKLGAFHHLPHGVANAVILTEVMRYNAAEVPTKMGTFS
QYQYPHALARYAELGRFAGCTGKDDKEVFENFIAKLEELKEKIGIKKTIKDYGIDEKYFL
DTLDEMSEQAFNDQCTGANPRYPLIQEIKDLYLKCYYGK
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagaagcggcaaaaactgtagagacaaagacagtaaacaccggattcgtt
gataacgttgaagctcttgaagcaaaaatgaaagagatgcgcgaggcacagaaaatcttc
gctacatttacacaggagcaggttgacaaaatcttctatgaagcagctatggcagcaaac
aagcagcgtatcccgcttgcaagacttgcagtagaagagactcagagaggtattctcgag
gataaggttatcaaaaaccattacgcagcagagtatatttacaacgcatacaaagataca
aagacatgtggtgttgtagaagaagataaggcattcggaatcaaaaagatcgcagagcca
atcggacttgttgcagcagttatccctacaacaaacccaacatcaacagcaatctttaaa
acactgatctgcttaaagacaagaaatgcaatcatcatcagcccacatccggctgctaaa
gcatctacaatcgcagcagctaaagttgttcttgatgcagcagtgaaagcaggagctccg
gaaggaatcatcggttggatcgatgctccatcactggaacttacaaacacagtaatgaga
gatgcagatatcatccttgcaacaggtggtcctggaatggttaaagcagcttactcttca
ggaaagccggcactcggagttggagctggtaacacaccggttatcatcgacgatacagca
gatgtaagaatggcagttaactcaatcatccactctaagacatttgataatggtatgatc
tgtgcttctgagcagtctgtgacagtacttgaaagcgtatatgaggaagctaagaaagaa
ttccagtacagaggatgctacttcctgaaaccaggtgaggagcttgacaaagttcgtaag
acaatcatcatcaacggtgcgctgaatagcaagatcccaggaaaatcagcttatgaaatc
gctcagatggcaggcgttgatgtaccgaagaatacaaagatcttgatcggagaagttgaa
tctgtagatatttcagaagaatttgcacatgagaaattatcaccggtacttggtatgtac
aaagctaaaacatttgatgaggctcttgagaaagcagctcagcttgtagcagacggtgga
tatggacatacatcttcactctacgtacatccggcagagacagagaaaatcgcaaaacat
gcagcagcaatgaagacttgccgtgtactgatcaacacaccttcttctcacggtggaatc
ggagacctttataacttcaagatggctccgtcccttacacttggatgtggatcatggggt
ggaaactctgtatcagagaacgtaggagtaaaacatctgcttaacattaagacagttgca
gagaggagagaaaatatgctgtggttcagaacacctgagaaagtttacttcaagaaaggt
tctatgccggttgcactggatgagcttggaacagtaatgcataagaagaaagcatttatc
gtaacagactccttcctttacaagaacggatatgtaaaaccgatcgaagataaattagat
gaaatgggaatccagcatacatgcttcttcgaagtagcaccagacccgacacttcagtgt
gcacgcaagggtgttgaccagatgagacagttcgagccagatacaatcatcgctcttggt
ggtggatctgcaatggacgcaggtaagatcatgtggatcatgtatgagcatccggaagca
aacttcgaagatatggctatggacttcatggacatccgtaagagagtatttacattccct
aagatgggagagaaagcttacttcgtagctatcccaacatcttcaggaacaggttctgag
gtaacaccattcgcaatcatcacagacgctgacacaggtgttaaatggccaatcgctgac
tacgctctgcttccaaacatggcaatcgtagacgtagacaacatgatgacacagccgaag
ggactgacaagtgcttcaggtatcgacgttatgacacatgcaatcgaggcatatgtatct
attatggctacagattacacagatggtcttgctatgaaggctgttaagcttgtattcgag
aaccttccatctgcatacgagaacggagcaaacgatccgaaggctcgtgaagagatggca
aacgcttcctgtatggctggtatggcattcgcaaatgcattccttggtgttaaccactcc
atggctcataagcttggtgctttccaccatctgccacacggtgttgctaacgcagtaatc
cttacagaggttatgagatacaatgcagcagaggttccgacaaagatgggaacattctca
cagtatcagtacccacatgcacttgcaagatacgcagaactcggacgtttcgcaggatgc
acaggtaaagatgacaaagaagtatttgagaactttatcgctaaacttgaagaactcaaa
gagaagatcggaatcaagaagacaatcaaagattacggcattgatgagaagtacttcctt
gacacacttgatgaaatgtcagagcaggcattcaacgatcagtgtacaggagctaaccca
agatacccactcatccaggagatcaaagatctgtacctgaaatgctactacggaaaataa

DBGET integrated database retrieval system