KEGG   Ruminococcus torques: RTO_18920Help
Entry
RTO_18920         CDS       T02606                                 

Definition
Aspartate/tyrosine/aromatic aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rto  Ruminococcus torques
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rto00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    RTO_18920
   01230 Biosynthesis of amino acids
    RTO_18920
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RTO_18920
   00290 Valine, leucine and isoleucine biosynthesis
    RTO_18920
Enzymes [BR:rto01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     RTO_18920
    2.6.1.66  valine---pyruvate transaminase
     RTO_18920
Amino acid related enzymes [BR:rto01007]
 Aminotransferase (transaminase)
  Class I
   RTO_18920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1965339..1966835)
Genome map
AA seq 498 aa AA seqDB search
METFADRLKAAMNEQGLKQVDLVRLAQQKGIKLGKSHVSQYVSGKTIPRTDILHFLADAL
QVDPDWLNNNNDNDSTLSDVDKIQTSADNSGGMKVREFKKSSKLNNVLYDVRGPVVDEAA
RMEEMGTHVLKLNIGNPAPFGFRTPDEVIYDMSRQLSDCEGYSASAGLFSARKAIMQYAQ
LKHLPNVTMSDIYTGNGVSELINLTMSALLDTGDEILIPSPDYPLWTACATLAGGKPVHY
ICDEQSDWYPDIEDMRKKINDRTKAIVIINPNNPTGALYPKEVLQQIVDLAREHQLIIFS
DEIYDRLVMDGKEHVSIASLAPDLFCVTFSGLSKSHMIAGFRIGWMILSGNKNIARDYIE
GIKMLSNMRLCSNVPAQSIVQTALGGHQSVNDYIVPGGRIYEQREYVYKALTDIPGISAV
KPQAAFYMFPKIDTKKFNIVNDEKFALDLLRDKKILIVQGSGFNWHQPDHFRVVYLPRIE
VLKEAVGKIGEFLQYYRQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaacctttgcagacagattaaaagccgctatgaacgagcaaggcctgaagcaggtt
gatcttgttcgtcttgcccagcagaaagggatcaagcttgggaaaagtcatgtcagccag
tatgtcagtgggaagacaatcccgcgtaccgacatcttacattttctggcagatgccctg
caggttgatcctgactggttaaacaataataatgataatgattccacactgtcagatgtt
gataagatacagacatccgcagataattcaggaggtatgaaagtgagagaattcaagaaa
tcatccaagttaaataatgtattatatgatgtgagaggtccggttgttgatgaggctgcc
agaatggaagagatgggaactcatgtactgaagcttaatatcggaaatccggctccgttt
ggcttccgtacaccggatgaggtgatctatgacatgagccgtcagctttctgactgcgaa
ggctactctgcttctgccggtctgttctctgcgcgaaaagcgatcatgcagtatgcccag
ttaaagcacctgccgaatgtaacgatgagcgatatttacacaggaaatggtgtcagtgaa
ctgatcaatcttaccatgtctgctcttttggatacaggggatgagattcttatcccgtct
ccggattatccgctctggacagcttgtgctacacttgccggtggaaagcctgtgcactat
atctgtgatgagcagtctgactggtatccggatatcgaagatatgcgtaagaagatcaat
gaccgtacaaaagcgatcgttatcatcaatccaaacaatccgaccggtgctctttatccg
aaggaagtactgcagcagattgtagacctcgcaagagaacaccagctgatcattttctct
gatgagatttatgaccgtcttgttatggatggaaaagagcatgtttctatcgcttctctt
gcaccggatctgttctgcgtgacattcagcggactgtccaagtcccatatgatcgccgga
ttccgtatcggatggatgatcttaagtggaaataaaaatattgcaagagactatatcgaa
ggaatcaagatgctttccaacatgcgtctttgctctaacgttccggcacagtccattgta
cagacagctctcggcggacaccagagtgtaaatgattatattgttccgggtggacgtatt
tatgagcagcgtgaatatgtttacaaggctctgacggatattccgggaatcagcgcagta
aaaccgcaggctgcattttatatgttcccgaagattgatacgaagaagttcaatattgtg
aatgatgagaaatttgctcttgatctgcttcgtgacaagaagatcctgatcgttcaggga
agtggatttaactggcatcagccggatcatttccgcgtggtttatctgccgcgtattgaa
gtgctgaaagaggcggttggtaaaatcggggagttcctgcagtattatagacagtag

DBGET integrated database retrieval system