KEGG   Ruminococcus torques: RTO_20630Help
Entry
RTO_20630         CDS       T02606                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rto  Ruminococcus torques
Pathway
rto00340  Histidine metabolism
rto01100  Metabolic pathways
rto01110  Biosynthesis of secondary metabolites
rto01230  Biosynthesis of amino acids
Module
rto_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rto00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RTO_20630
Enzymes [BR:rto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RTO_20630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh EcoEI_R_C
Motif
Other DBs
NCBI-ProteinID: CBL26589
UniProt: D4M5S7
Position
2139524..2140816
Genome map
AA seq 430 aa AA seqDB search
MRIEKLNKNTKKNLLDDLLKRSPNNYGKFEASVQEILNAVKEKGDEAVFEYTEKFDGVRL
DAEHLLVTEEEIAEAYEQVDDELIAIIRKALVNIRDYHQKQMQYSWFDSKPDGTILGQKV
TALQRVGVYVPGGKAAYPSSVLMNIMPAKVAGVDEIIMVTPPGKDGKVTPTTLVAAKEAG
ADKVYKVGGAQAIAALAYGTESIPKVDKIVGPGNIYVALAKKAVYGFVSIDSIAGPSEIL
VLADETANPRFVAADLLSQAEHDEMASAILVTTSMELAEKVSAQTDAFVKELSRGEIIQK
SLNNYGHILVAETMGDAIDAANSIASEHLEIVTANPFEVMTKIRNAGAIFIGEYSSEPLG
DYFAGPNHVLPTNGTAKFFSPLSVDDFIKKSSIISYSRNALEKIHTDIEKFAEAEHLTAH
ANSIKVRFEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatagagaaactgaataagaatacgaagaagaatcttctggatgaccttttaaag
agaagcccgaataactatgggaagtttgaagcaagtgttcaggaaatattgaatgcggtg
aaagaaaagggagacgaggctgtatttgaatatacagagaaatttgatggagtcagactg
gacgcagagcatcttcttgtaacggaagaagagatcgcagaagcatatgagcaggtagat
gatgaactgatcgcgattatcagaaaagcactggtgaatatcagagactatcaccagaaa
cagatgcagtacagctggtttgacagtaaaccggacggaacaattcttggacagaaagtg
acagcactccagagagtcggtgtttatgttcctggcggaaaagcagcttacccatcttct
gtacttatgaatatcatgccggcgaaggttgcaggtgtagatgagatcatcatggtaaca
cctccaggaaaagatgggaaggtaactccgacaacactggttgcggcaaaagaggccggt
gcagataaagtttacaaggttggtggagctcaggcaattgcggcacttgcatatggaaca
gagtctattccgaaggtagataagatcgtaggacctggaaatatctatgtagctcttgct
aagaaagcggtttatggattcgtaagcattgactcaatcgcaggaccaagtgagatcctt
gttcttgctgatgagacggcaaatccacgtttcgtggcagcagatcttctgtctcaggca
gagcatgacgagatggcatctgcaattctggttacaacaagtatggaacttgcagagaaa
gtatctgcacagacagatgcatttgtaaaagagctttccagaggcgagatcattcagaaa
tccctgaataattatggacatattctcgtcgcagagacaatgggggatgcaatcgatgca
gcaaattctattgcttccgaacatcttgagatcgtgacagcgaatccgtttgaggtgatg
acaaagatccgtaatgccggagctattttcatcggagaatattccagtgagccgctcgga
gattattttgcaggaccgaaccacgtccttccgacaaacggaacagcaaaattcttctca
ccgctatctgtagatgattttattaaaaaatcaagcattatttcttactcaagaaatgca
cttgagaagatccacacagatatcgagaaatttgcagaggcagaacatctgacagcacat
gcaaattcaatcaaagtaagatttgaaaaataa

DBGET integrated database retrieval system