KEGG   Ruminococcus torques L2-14: RTO_25230Help
Entry
RTO_25230         CDS       T02606                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rto  Ruminococcus torques L2-14
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rto00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rto00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rto00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2620475..2622664
Genome map
AA seq 729 aa AA seqDB search
MGIIYCEKDRTFTLQTKNTTYQMQVDRYGFLLHLYYGKKTDGCMDYLLTYYDRGFSGNPY
DAGEDRTYSMDTLPQEFPCYGNGDFRSTAFAVENADGSMSCDLRYKSHVILDGKYNLEGL
PAVYASEEEAQTLEILMEDPVTGVKVVLLYGVLPAQDIITRSVSVKNESSGKIYLNKIES
TSLDFLYGDYELLTFYGRHAMERNVQRVPVVHGTQKIGSVRGTSSHQYNPMMILAEKETT
EDKGNCYAMSFVYSGCFQGEVLKDQLNQTRMMLGLQEEAFRYPLETGEMFQAPEVILSYS
SEGMNRLSQNLHHCIRQHICRGKYKEEIRPILINSWEAAYFDFTGDTIYELAKAAKEVNI
DMLVMDDGWFGKRDDDNSGLGDWFVNEKKLGGTLGNLIKRINDLGVKFGIWIEPEMVSED
SDLYRKHPDWALTVPGRNPVRSRNQLVLDFSRKEVVDEIYDQICKVLDQGNIEYVKWDMN
RSLMDVYSSVTRDQGRVLHDYVLGLYDFLERLVQRYPNLLIEGCSGGGGRFDAGMMYYTP
QIWCSDNTDAIDRLRIQYGTSFGYPVSVVGSHVSAVPNHQTGRKTPLHTRGVVAMSGTFG
YELNLMKLSEEEKQEIREQIAEYKSYAPIIQNGLYYRLSDPTTGEICAWEFVHTDEKEQS
KVLLNIVMQVIHGNMTVNYVKLQGLEETAVYREEKSGKRYTGAALMYGGMPLPIEPGEYQ
AYQYCFVKE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgggaattatatattgcgagaaagacagaacatttactttacagacaaaaaatacaaca
tatcagatgcaggtggatcgctatggatttttgttacatctatattacgggaagaaaacc
gatggatgtatggactatcttctgacatattatgacaggggattttcgggaaatccatat
gatgcaggagaagatcgtacgtattcaatggatacacttccacaggaatttccttgttac
gggaacggggatttcagaagtacagcatttgcagtagaaaatgcagatggaagtatgagc
tgcgaccttcgttacaagagtcatgtaatccttgatggaaaatataatctggaaggactt
ccggcagtttatgcaagtgaggaggaagcacagacactggaaatcttaatggaagatccg
gtgacgggagttaaggtggtgcttctttatggagtgcttcccgcacaggatattattaca
agaagtgtaagtgtgaaaaatgaaagcagtggcaaaatctatttaaacaaaattgagtca
acaagtctggatttcctttacggagattatgagcttctaacattttatggtagacatgcg
atggagcgaaatgttcagagagttccggttgtgcatggaacacagaaaatcggaagtgtc
agaggaacctccagtcatcagtacaatccgatgatgatccttgcagaaaaagaaacgaca
gaagacaaaggaaattgttatgcaatgtcctttgtatacagtggatgtttccagggagaa
gtgttgaaagatcagttaaaccagacaagaatgatgctaggacttcaggaagaagctttt
cgctatccgttggaaacaggagaaatgttccaggctccggaagtgattttatcctattcc
tcagaaggcatgaatcgtttgtctcagaatctgcatcattgtatcagacaacatatctgc
agaggcaaatataaagaagaaattcgtccaatcttgatcaatagctgggaagcagcttat
ttcgattttaccggagatacaatctatgagcttgccaaagcggcgaaggaagtcaatatt
gacatgcttgttatggatgatggttggtttggaaaacgtgatgatgataatagcggactg
ggtgactggtttgtgaatgagaagaaacttggtggcacacttggaaatctgatcaagaga
attaatgatctgggtgtgaagtttggtatctggatcgagccggaaatggtttcagaagac
agtgatctttatcggaaacacccggactgggcattgacggttccgggcagaaatccggtc
agaagcagaaatcagcttgtattggatttttcaagaaaagaagttgtagatgaaatttat
gatcagatttgcaaggtgttggatcagggtaatatcgaatatgtaaaatgggatatgaat
cgaagcctgatggatgtttattcttctgtaacaagagatcagggaagagtgttacatgat
tatgtattgggactatatgattttctggaacgtcttgtgcagagatatccgaatctactg
atcgaaggctgcagcggtggaggtggaagatttgatgccggtatgatgtattacactccg
cagatctggtgtagtgataatacggatgcaattgacagattacggatccagtatggaaca
tctttcggttatccggtatcggtagtaggttctcacgtgtcagcagtgccgaatcatcag
acgggaagaaagaccccacttcatacaagaggtgttgttgcaatgtccggaacttttggg
tatgagctgaatcttatgaaactttctgaagaagaaaagcaggagatcagagagcaaatc
gcagaatacaagagctatgcgccgatcattcagaacggattgtactatcgtctctcagat
ccgacaacaggagaaatctgcgcatgggagtttgtgcatacagatgagaaagaacaaagt
aaagttcttttaaatatagttatgcaggtgattcatggaaatatgacagtaaattatgta
aaacttcaagggcttgaagaaacagctgtatatcgagaagaaaagagtggaaaaagatac
accggagctgcacttatgtatggcggcatgccgcttccgatagagccgggcgaatatcag
gcatatcagtattgttttgtgaaagagtaa

DBGET integrated database retrieval system