KEGG   Ruminococcus torques: RTO_27100Help
Entry
RTO_27100         CDS       T02606                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rto  Ruminococcus torques
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rto00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RTO_27100
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RTO_27100
Enzymes [BR:rto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RTO_27100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2829737..2830345
Genome map
AA seq 202 aa AA seqDB search
MGQITVEKNVGGIEGLCVITPAVHGDARGYFMETYNENDMKEAGIDIKFVQDNQSMSTKG
VLRGLHFQKQYPQCKLVRTVRGSVFDVAVDLRLGSETYGKWYGVELTEENKKQFLIPKGF
AHGFLVLSEIAEFCYKCDDFYHPNDEGGMAWNDPEMGIEWPQVKGEYLGNALAEGYELED
GTKLNLSEKDQKWLGLKDTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacagattacagtagagaaaaatgtgggtggaattgaaggactgtgtgtgattact
ccggcggtacatggagatgcacgcggatacttcatggaaacttacaatgagaatgatatg
aaagaggcaggaattgacatcaagtttgtacaggataatcaatccatgtctacaaaaggt
gtgctgagaggactgcattttcagaagcagtatccgcagtgtaaactagtccgaacggtg
agaggttctgtgtttgatgtagcagttgatttgcgattaggcagtgaaacttatggaaaa
tggtatggcgttgaattgacagaagagaataagaagcaatttttaattccaaaaggattc
gcacatggattcttagtgcttagtgagatagcagagttctgttataaatgtgatgatttt
tatcatccgaatgatgaaggtggtatggcctggaatgatccggagatgggtattgagtgg
ccacaggtgaaaggtgagtatctgggaaatgcattagcagaaggatatgaactggaagat
ggaacgaagcttaatctgagtgagaaagatcagaagtggctggggttgaaggatacattt
aaattttaa

DBGET integrated database retrieval system