KEGG   Ruminococcus torques L2-14: RTO_27100Help
Entry
RTO_27100         CDS       T02606                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rto  Ruminococcus torques L2-14
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rto00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rto00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2829737..2830345
Genome map
AA seq 202 aa AA seqDB search
MGQITVEKNVGGIEGLCVITPAVHGDARGYFMETYNENDMKEAGIDIKFVQDNQSMSTKG
VLRGLHFQKQYPQCKLVRTVRGSVFDVAVDLRLGSETYGKWYGVELTEENKKQFLIPKGF
AHGFLVLSEIAEFCYKCDDFYHPNDEGGMAWNDPEMGIEWPQVKGEYLGNALAEGYELED
GTKLNLSEKDQKWLGLKDTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacagattacagtagagaaaaatgtgggtggaattgaaggactgtgtgtgattact
ccggcggtacatggagatgcacgcggatacttcatggaaacttacaatgagaatgatatg
aaagaggcaggaattgacatcaagtttgtacaggataatcaatccatgtctacaaaaggt
gtgctgagaggactgcattttcagaagcagtatccgcagtgtaaactagtccgaacggtg
agaggttctgtgtttgatgtagcagttgatttgcgattaggcagtgaaacttatggaaaa
tggtatggcgttgaattgacagaagagaataagaagcaatttttaattccaaaaggattc
gcacatggattcttagtgcttagtgagatagcagagttctgttataaatgtgatgatttt
tatcatccgaatgatgaaggtggtatggcctggaatgatccggagatgggtattgagtgg
ccacaggtgaaaggtgagtatctgggaaatgcattagcagaaggatatgaactggaagat
ggaacgaagcttaatctgagtgagaaagatcagaagtggctggggttgaaggatacattt
aaattttaa

DBGET integrated database retrieval system