KEGG   Ruminococcus torques L2-14: RTO_27280Help
Entry
RTO_27280         CDS       T02606                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rto  Ruminococcus torques L2-14
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rto00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2849172..2849801
Genome map
AA seq 209 aa AA seqDB search
MAKLYFRYGAMGSSKSANILMVRYNYEERNQYAVLLKPRTDNRDGEQEIMSRIGLSAPAG
YVDDFLQGVSKEWKAGSKEYFHQGKKVDAILVDEAQFLSENEIDMLSDIVDFYDIPVLCY
GLRTDFLCQLFPGSRRLMEIADVIEEVPTVCWCGKRAQCNTRYADGKIVRKGAQVMLGSN
ESYVALCRKHYKEGRLWEHDPGDIPGDNN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattatattttcgatatggagcaatgggaagttctaagtcagcaaatattctg
atggtgcgatataattacgaggaacgtaatcaatatgctgttttattgaaaccgagaaca
gacaacagagatggagaacaggaaatcatgtctcgtatcggcttgtctgctccggcagga
tatgtagatgattttttgcaaggggtttccaaggaatggaaggcgggcagtaaggagtat
tttcatcaagggaaaaaggtagatgcaattcttgttgatgaagcacagtttctttcagag
aatgagatagatatgctgtctgacattgtggacttttatgacattcctgtactgtgttat
ggactacggacagatttcctatgtcagctgtttccaggctccagaaggcttatggagatt
gcagatgttatagaagaggttccgacggtttgctggtgcggaaagcgtgcgcagtgcaac
acaagatatgcagacggcaagattgttagaaaaggcgcacaggtcatgcttggatcgaat
gaaagctatgtagcattatgcaggaagcattacaaggaaggccgactgtgggaacatgat
ccgggagatattccgggtgataataattaa

DBGET integrated database retrieval system