KEGG   Ruminococcus torques: RTO_31880Help
Entry
RTO_31880         CDS       T02606                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rto  Ruminococcus torques
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RTO_31880
Enzymes [BR:rto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RTO_31880
Exosome [BR:rto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RTO_31880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3277436..3279361
Genome map
AA seq 641 aa AA seqDB search
MVKKNSTKTKVQPYEIGELDHYLFGQGNHYEIYKKMGAHEVTKNGKRGVYFAVWAPHAVN
VSVIGEFNDWDETKDKMKRGEPLGIYTCFVPEAKKGDLYKFCIETQAGEKIYKADPFANY
AELRPGTASRITDISNLNWSDSKWMTAREKWDNKEEPVSIYEVHMGSWMRHPGREDEGFY
TYREFAEAITKYVKEMGYTHVELMGIAEHPFDGSWGYQVTGYYAPTSRYGTPEDFAYMVN
YLHKNNIGVILDWVPAHFPKDAHGLADFDGTPTFEYPDPRKGEHPDWGTKVFNYEKPEVS
NFLLANALFWVEHYHVDGLRVDAVASMLYLDYGREDGQWIPNKFGGNENLEAIAFFKHLN
SVVCGRNKGIMMIAEESTAWPKVTGSPEDDGLGFTLKWNMGWMHDFTEYMKLDPYFRKNA
HHMMTFSMEYAYSENYILVLSHDEVVHLKCSMLNKMPGEGWDKFRNLKVAYAFMMGHPGK
KLLFMGQEFAQLREWSEERELDWFLLAEEPHQQIQNWYKDLLHLYKKNKALYELDNDPKG
FDWINKDDIFRSIFSFTRHSKDGKKNLLFVCNFTPVDRPDYRVGVPRRKQFKLVLNSDET
KYGGSGEERPLVYKPEKQECDGQKYSFAYPLPGYGVAVFEY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaaacagcacgaagacgaaagtgcagccttatgagatcggagaacttgac
cattatctttttgggcagggaaatcattatgagatttataaaaagatgggtgcccatgag
gtgacaaagaacggaaaaagaggagtatattttgcggtatgggctcctcatgcagtaaac
gtttctgtaatcggagagtttaatgactgggatgagacgaaagataagatgaagagagga
gagcctctcggaatatacacatgcttcgttccggaggcgaagaaaggggatttgtataag
ttctgtatagagacacaggcgggtgagaagatctataaagcagatccatttgctaattat
gcagaactccgaccgggaacagcatccagaattacagatatttctaatctgaactggtca
gacagtaagtggatgacagctcgtgagaagtgggataacaaagaagaaccagtgtctatt
tacgaagtgcatatgggttcctggatgagacatcctggaagagaagatgaaggattctat
acatatcgtgagtttgcagaagcaattacaaagtatgtaaaagagatgggatatactcat
gtcgagttgatgggaatcgcagagcatccgtttgacggttcctggggatatcaggtaacc
ggatattatgcaccaacttcacgctatggaacaccggaagattttgcatatatggtaaat
tatcttcataagaataatatcggtgttattcttgactgggtaccggcgcatttcccgaaa
gatgcacatggtctggcagattttgacggaacaccgacattcgaatatccagatccgaga
aaaggtgagcatcctgattggggaacgaaggttttcaattatgaaaaaccggaagtttct
aacttccttctggcgaatgcattgttctgggttgaacattatcatgtagacggacttcgt
gtagatgcagtggcatctatgctgtatctggactacggaagagaagatggacagtggatt
ccgaataaatttggtggaaatgagaatcttgaggcaattgcattctttaaacatctgaat
tctgtagtttgcggaagaaataaaggcattatgatgatcgcagaagagtctacagcatgg
ccgaaggtgacaggatctcctgaggatgacggacttggatttactttgaagtggaatatg
ggatggatgcatgactttacagaatatatgaaactggatccttatttcagaaaaaatgca
catcatatgatgacattttctatggaatatgcatattcagagaactatattcttgtactt
tctcatgatgaggttgttcatctgaaatgctccatgttgaataagatgccgggagaagga
tgggataagttccgcaacttgaaggtggcatatgcatttatgatgggacatcctggaaag
aagcttctctttatgggacaggagttcgcacagcttcgtgagtggagtgaagagagagaa
ctggattggttccttcttgcagaagaaccacatcagcagattcagaactggtataaagat
ttgcttcatctttataagaagaataaggcattgtatgagttggataatgatccgaaggga
tttgactggatcaataaggatgatatcttccggagtattttcagtttcacaagacattca
aaggatgggaagaagaatctactttttgtatgcaactttacaccggtagacagaccggat
taccgtgttggtgttccgagaagaaagcagtttaagcttgttcttaacagtgatgagaca
aaatacggcggatcaggagaagaacgcccattggtttacaagccagagaaacaggaatgt
gatggtcagaaatattcctttgcatatcctcttccgggatatggtgtggcagtatttgag
tattaa

DBGET integrated database retrieval system