KEGG   Rhizobium tropici: RTCIAT899_CH00280Help
Entry
RTCIAT899_CH00280 CDS       T02432                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rtr  Rhizobium tropici
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RTCIAT899_CH00280 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RTCIAT899_CH00280 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RTCIAT899_CH00280 (glcB)
Enzymes [BR:rtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RTCIAT899_CH00280 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59867..62038
Genome map
AA seq 723 aa AA seqDB search
MSRIEKHGLQIEQVLYDFLVKEALPGSGADAEAFFAGFSKIVHDLAPRNRELLAKRDRMQ
EALDDWYRKNGAPVDLAAYEAFLREIGYIVPEGPAFTISTANVDPEISETAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPETDGAEKGRGYNPKRGEKVIAWVRDFLDSAVPL
TGASWKDVTGLAVKDGALAVTTDGGAVKLADGSHFAGYLGDATTPTHILLQQNGIHIEIV
IDTTTAIGKSDPAGISDVRLESAITTIMDCEDSIAAVDAEDKAEVYRNWLGLMKGDLTEE
VVKGDKTFTRRLNPDVVYTAPDGSTFDLHCRSLMLVRNVGHLMTNPAILDRDGNEVPEGI
MDAAITGLIALYDIGPNGRRKNSRTGSMYVVKPKMHGPEEVAFAVDIFSQVEDLLGMPRN
TIKMGIMDEERRTTVNLKEAIRAARERVVFINTGFLDRTGDEIHSSMEAGPMIRKGDMKQ
AAWIGAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSP
TAATLHATHYHRVNVADVQKSLKSRARAKLSDILSVPVASRPNWTPEEIQREIDNNSQGI
LGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHKVISQAQIVETMKRM
AAVVDQQNADDPNYIPMAGNFDGSVAFQAALDLVLKGREQPNGYTEPVLHRRRIELKAKQ
AGL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgaaaaacacgggcttcagatcgaacaggtcctctacgatttcctcgtc
aaggaggcgctaccgggttcgggcgcggatgcggaggccttcttcgccggcttttccaag
atcgtccacgatctcgcgccaaggaaccgcgagcttctcgccaagcgcgaccgcatgcag
gaagcacttgatgactggtaccgcaagaacggcgcccctgtcgatcttgctgcctacgaa
gccttcctgcgcgagatcggctatatcgtgcccgaaggcccggccttcacgatctcgacc
gccaatgtcgacccggaaatctcagagaccgccggcccgcagctcgtcgttcccgtcatg
aatgcccgctatgccctgaatgcggccaatgcccgctggggatcgctctacgatgccctc
tacggcaccgatgccattccggagaccgatggcgccgaaaagggtaggggttataacccc
aagcgcggcgagaaggtcatcgcctgggttcgtgatttcctggattccgccgtgccactt
accggtgccagctggaaggatgtcaccggccttgccgtgaaggatggcgccttagcggtt
acgactgatggcggtgcggtaaagcttgccgacggcagccatttcgccggctatctcggc
gatgccactacccccactcatatcctgctgcagcagaacggcatccatatcgaaatcgtc
atcgacacaaccacggccatcggcaagtccgacccggccggcatttccgatgtccgcctg
gaatcggcaatcacgacgatcatggactgcgaggattcgatcgcagccgtcgatgccgag
gacaaggccgaagtttaccgcaactggctcggcctgatgaagggcgatctgacagaggaa
gtcgtcaagggtgacaagaccttcacgcgccggctcaatcctgatgtcgtctatacggca
ccggatggcagcaccttcgatctgcattgccgttccctcatgctggtccgcaatgtcggc
cacctgatgaccaatccagccatcctcgaccgtgacggcaacgaggtgcctgagggcatc
atggacgctgccatcaccggcctgatcgcgctctacgatatcggcccgaacggccgccgc
aagaattcccgcaccggctcgatgtatgtcgtcaagccgaagatgcacggtcccgaagaa
gtcgccttcgcggtggatatcttctcgcaagtcgaggacctgcttgggatgccgcgcaac
accatcaagatgggcatcatggacgaggagcgtcgcacgacggtcaacctcaaggaagcc
attcgcgccgcccgcgaacgcgtcgtcttcatcaacaccggcttcctcgatcgcaccggt
gatgaaatccatagctcgatggaagccggcccgatgatccgcaagggcgatatgaagcag
gcggcctggatcggcgcctatgagaactggaatgtcgatgtcggcctcgaatgcggcctt
tccggccatgcccagatcggcaagggcatgtgggccatgccggacctgatggcggccatg
ctcgagcagaagatcgcccatcccaaggccggcgccaataccgcctgggtgccgtccccg
accgccgccacgctgcacgccacccattaccatcgtgtcaacgttgccgacgtccagaag
agcctgaagagccgcgcccgcgccaagctttccgacatcctctccgtgcccgtcgcctcg
cggccgaactggacgccggaggaaatccagcgcgagatcgacaataacagccagggcatt
ctcggctatgtcgtgcgctgggtggatcagggcgtaggctgctccaaggtgcctgacatc
aacaatgtcggcctgatggaagaccgagccaccctgcgtatctcagcgcagcatatggcg
aactggctgcatcacaaggtcatcagccaagcgcagattgtcgaaacgatgaagcgtatg
gccgccgtggttgaccagcagaatgccgacgatcccaattatattcccatggccggcaat
ttcgacggctccgtcgccttccaggccgccctcgatctcgtcctcaagggacgcgagcag
ccgaacggctataccgaaccggtcctgcatcgccgccgcatcgaactgaaggcaaagcag
gcggggttataa

DBGET integrated database retrieval system