KEGG   Rhizobium tropici: RTCIAT899_CH00690Help
Entry
RTCIAT899_CH00690 CDS       T02432                                 

Definition
putative cytochrome c-like protein
Orthology
K08738  
cytochrome c
Organism
rtr  Rhizobium tropici
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RTCIAT899_CH00690
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RTCIAT899_CH00690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142815..143393
Genome map
AA seq 192 aa AA seqDB search
MNSSYVNMGVGALLATLFVLKSVSLASGFIFHSEAPEKPGFTIVATEEPAAGGDKGAAAK
PDTPIAQLLQKADAKVGETIFKKCQACHSGEKGGPNKVGPDLWGIVDRPVAEHEGFAYSS
GMKDFSKGGTEKWTYDHLYHFLAAPKKFVAGTAMGFAGLPKEEDRANVIAYLRTLADTQV
PLPDPNAPAATN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatcctacgtgaacatgggtgtcggggcgcttttggccacgctgttcgtgttg
aagtccgtgtcgctcgcgtcaggatttattttccattcagaggcgccggaaaagcccggt
tttaccatcgtcgcgaccgaggaaccggctgcgggcggcgacaagggcgcggctgccaag
ccggatacgccgatcgctcagcttctgcagaaggctgatgccaaggtcggcgaaacgatc
ttcaagaagtgtcaggcctgtcattccggagaaaagggtggtccgaacaaggttggtccc
gatctctggggtattgtcgaccgcccggtcgccgagcacgagggcttcgcctattcgtcc
ggcatgaaggatttttccaagggcggtacggaaaagtggacctatgaccacctctatcac
ttcctggccgcgccaaagaaattcgtcgccggaacggcaatgggctttgccggcctgccg
aaggaagaggatcgcgccaacgtgatcgcctatctgcgcacgcttgccgatacccaggtg
ccgctgccggacccgaacgcaccggccgccacgaactaa

DBGET integrated database retrieval system