KEGG   Rhizobium tropici: RTCIAT899_CH01285Help
Entry
RTCIAT899_CH01285 CDS       T02432                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rtr  Rhizobium tropici
Pathway
rtr00240  Pyrimidine metabolism
rtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RTCIAT899_CH01285 (deoA)
Enzymes [BR:rtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RTCIAT899_CH01285 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Ald_Xan_dh_C
Motif
Other DBs
NCBI-ProteinID: AGB69676
UniProt: L0LG62
Position
269852..271159
Genome map
AA seq 435 aa AA seqDB search
MIPQEIIRQKRNGATLSAADIDAFIGALGRGELAESQIGAFAMAVWFRGMTREETVALTL
AMARSGDILSWRGIGRPIADKHSTGGVGDNVSLMLAPIAAACGLAVPMISGRGLGHTGGT
LDKLESIPGYGITPDAARFRKVVDEVGCAIIGQTGALAPADGKLYAVRDVTATVDSVPLI
TASILSKKLAAGLETLVLDVKIGSGAFMTSQEEAETLARSLVEVANGGGVRTSALITDMN
QPLADAAGNVVELRNCLDFLKGNKAGTRLETVVLAFASEMLVQAGIAANAADAESRAREA
LASGKAAEIFGRMVHALGGPADLLEHPDRYLASAPVQKPVLAAADGWLGACDAREIGMSV
IDLGGGRRRPQDKIDHRVGFSDILPLGTKVSRGDRIATVHAADEASAQKAAGALSANYRT
VDTAPALSPVIVRRI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcaggagatcatccgtcagaagcgtaacggcgccaccctttcggctgccgat
atcgatgcgtttatcggtgctttggggcggggcgaactggcggaaagccagatcggcgct
tttgccatggccgtctggtttcgcggcatgacgcgggaggaaacggtggcgctgacgctc
gccatggctcgctccggcgatatcctttcctggcgaggcatcggcaggccgattgccgac
aagcattcgactggcggtgtcggcgacaacgtctctctgatgctcgctcccatcgccgcc
gcctgcggcctcgccgtgccgatgatctctggtcgcggtctcggccataccggcggcacg
ctggacaagctggaatccattcccggttacgggatcacgccggatgccgcccgtttccgc
aaggtggtcgatgaggtcggctgcgccatcatcggtcagaccggcgcgctggcgcccgcc
gacggcaagctctatgcggtgcgcgatgtcacggcgaccgtcgattccgtgccgttgatt
accgcctccatcctgtcgaagaaactggccgcgggactggaaacgctggtgctcgacgtc
aagatcggcagcggcgccttcatgacctcgcaggaagaagctgagaccctggcgcgctcg
ctggtggaggtggccaatggcggcggggtcaggacttcggccctgattaccgacatgaac
cagcccttggccgacgcggctggcaacgtggtcgaacttcgtaactgcctggatttcctg
aagggcaacaaggcaggcacgcgcctcgaaacagtcgtcctggccttcgcatccgaaatg
ctcgttcaggccggcattgccgccaacgctgccgatgcggagagcagggcgcgcgaggct
ctggcatccggcaaggcggcagagatcttcggccgcatggtgcacgcccttggcggcccc
gcggatctgctggaacacccggatcgctatttggcgagtgcgccggtgcagaagcccgtt
ctcgcggcggccgatggctggctgggcgcctgcgatgcgcgggagatcggtatgagcgtc
atcgatctcggcggcggccgccgccgcccgcaagacaagatcgatcatcgcgtcggcttc
agcgacattctgccgctcggcaccaaggtgagcaggggtgaccgcatcgctaccgtgcat
gcggcagacgaggcaagcgcgcaaaaggccgcgggcgctttgtcggctaactatcgcacc
gtggatacggcgcccgctttgtcgcctgtcattgtcagacggatttga

DBGET integrated database retrieval system