KEGG   Rhizobium tropici: RTCIAT899_CH01535Help
Entry
RTCIAT899_CH01535 CDS       T02432                                 

Definition
putative beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rtr  Rhizobium tropici
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RTCIAT899_CH01535
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RTCIAT899_CH01535
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RTCIAT899_CH01535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323915..325834
Genome map
AA seq 639 aa AA seqDB search
MQPSSYHLENTWSPEGGKHGRLTLTLFNFSDAPLQNFRLAYTTLTRLVDPQTCDNAVFVR
RNANFHEFAPPAGLSIAPGGSWTFTVSALHRIARHCTDGAKSAYVTLEDGAHVTVFTSDL
LLADRVSEPPPVLLPEGRLELPYAIQPWPAEIDVKPGEDFPVALYPAEGTDAASVKALAA
AQALFRRLFPSNHIPFSLIAAPQGRALRFVERPALAREAYELSFSGDEVVLSFSAEAGRL
YGLTTLAQLLDGARREPGKFRFPVSGQIADRPRYGWRGCHLDVSRQFTPKDDVLRLLDIL
AWLKLNIFHWHLTDDEAWRLEIRAYPQLTTTGVLRGPDEPLLPQLGNAAEPVGGFYSQDD
VREIVAHATALGIEVIPEIDIPGHSTATLVALPGLTDGQEAPDSYHSVQGFPNNALNPAI
ELTYEFLAKVFDEMVELFPSEYIHIGGDEVANGSWLASPLARKLMEREGISGTFALQSYF
LKRIKAMLTARGRKLAGWNEVAHGGGVDPEGTLLMAWEKPEVGIELAREGYEVVMTPGQA
YYLDMVQADAWQEPGASWAGTVPPAHTYAYEAEGDFPDELKHLMKGVQACIWQENFISRD
YFNRLVFPRLPGIAEAAWTPKAQKDWLRFAAIVPLSPKL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgtcctcctatcatctcgaaaacacctggtcgcccgaaggcgggaagcatggt
cgattgacactgaccctcttcaatttctcggatgcgcctcttcagaatttccgtctcgcc
tatacgaccctgacgcgcctcgttgatccccaaacctgcgacaacgccgtcttcgtccgc
cgcaatgcgaattttcatgaatttgcgccgccggccggcctctccatcgcacccggagga
agctggacgttcaccgtctcggcacttcaccgcatagcccgccattgcaccgacggcgcc
aaatccgcctatgtgacgctcgaagacggcgcgcatgtcacggtcttcacctcggatctg
ttgctcgccgatcgcgtcagcgagccgccgccggtcctgctgccggaaggcaggcttgag
cttccctacgcgatccagccgtggccggcggagatcgacgtcaagccgggcgaagacttt
ccggttgcgctctatccggccgaaggtaccgatgccgcaagcgtcaaggcgctggctgcg
gcgcaggcgctcttccgccgcctctttccgtccaatcacatccccttcagcctcatcgcc
gcgccgcagggtagggcgctgcgtttcgtcgagcggccggcactggcccgggaagcctat
gagctttccttctccggcgatgaagtcgtactttccttctctgccgaggcgggccgcctc
tacggtctgacgacgctggcacagcttctcgatggcgcacggcgcgagcccggcaagttc
cgcttcccggtatcgggccagatcgccgaccggccgcgctatggctggcgtggctgccac
ctcgacgtctcccggcagtttacgccaaaggacgacgtcctgcggctgctcgacattctt
gcctggctgaagctcaatatcttccactggcatctgaccgacgacgaggcctggcggctg
gagatccgcgcctatccgcagctgaccaccacgggcgtgctgcgcgggccggacgagccg
ctgctgccgcagctcggcaatgctgccgagccggttggcggtttctattcgcaggatgat
gtacgagagatcgtcgcccacgccacggcgctcggcatcgaggttatcccggaaatcgac
attcccggccacagcactgccaccctcgttgccctgcctggcctgacggacgggcaggag
gctcccgatagctatcactccgttcagggcttcccgaacaatgcgctgaaccccgctatc
gagctcacctacgagtttctcgccaaggtcttcgacgaaatggtcgagctctttccgtcc
gaatatatccatatcggcggcgacgaggtcgccaatggttcctggctcgcttcaccgctt
gcacgcaagctgatggagcgggaaggcatatcggggacattcgcgctgcagtcctatttc
ctcaagcgcatcaaggccatgctcaccgcccgcggccgcaagcttgccggctggaacgag
gtcgcccatggcggcggcgtcgatccggaaggcactttgctcatggcctgggaaaagccc
gaggtcggcatcgagcttgcgcgcgaaggctatgaagtggtgatgacccccgggcaagcc
tattatctcgacatggtgcaggccgatgcctggcaggaacccggcgcgagctgggcaggc
acggtgccgccggcccatacatatgcttacgaggccgagggcgatttcccggatgagctg
aagcatctgatgaaaggcgtccaggcctgcatctggcaggagaatttcatctcccgcgac
tatttcaaccgcctcgtcttcccgcgcctgcctggtattgccgaggcagcctggacgccc
aaggcacagaaggattggttgcgctttgccgccatcgtgccgctgagcccgaagctctag

DBGET integrated database retrieval system