KEGG   Rhizobium tropici: RTCIAT899_CH02200Help
Entry
RTCIAT899_CH02200 CDS       T02432                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rtr  Rhizobium tropici
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rtr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448817..449707
Genome map
AA seq 296 aa AA seqDB search
MPELPEVETVRRGLAPSMEGAVLKKLELRRNDLRFPFPADFARHVAGRGITSLSRRAKYL
LIDLDDGKTIVAHLGMSGSFRVEEGAAAETPGTFHHPRSKDEKHDHVLFHLVGASGDARV
IYNDPRRFGFMDLVRRTEMTSHPFFRDLGPEPTGNELSADYLAKRFGGKAQPLKSALLDQ
KNIAGLGNIYVCEALWRSHLSPLRAAGTLVTDAGQPTEALFTLVDAIREVIADAIAAGGS
SLRDHIQTDGSLGYFQHSFSVYDREAQPCRTPGCGGTVSRIVQAGRSSFYCASCQG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattaccagaggtcgaaaccgtcagacgcggccttgcgccttccatggagggt
gccgttctgaagaagctggagctgcgccgcaacgatctgcgctttcctttcccggccgat
ttcgctcggcatgttgcgggccgcggcatcacgtcgctgtcccgccgcgccaaatacctg
ctgatcgatctcgacgacggcaagacgatcgtcgcgcatctcggcatgtcaggctcgttc
cgggtggaggaaggtgctgcggccgagacgccaggaaccttccatcatccccgctccaag
gacgagaagcatgatcacgtcctcttccatctggtgggtgcaagcggcgatgcgcgcgtc
atctacaatgacccgcgccgcttcggttttatggatctcgtccggcggaccgagatgacc
agccatcccttcttccgtgatctcgggccggaacccacgggcaatgaactgagtgccgat
tatctggctaagcgctttggcggcaaggcgcagccgctgaagagcgcgctgctcgaccag
aaaaacatcgcgggcctcggcaatatatatgtatgcgaggcgctgtggcgttctcacctg
tcgccgttgcgcgccgccgggacgctggtcacggatgccggacagccgaccgaagcgctg
ttcacgctcgtcgatgccatccgcgaggtcattgctgatgcgatcgctgcaggcggttcg
tcgctgcgcgaccatatccagacggacggttcgctcggctatttccagcactccttttcc
gtctatgatcgcgaagcacagccttgccgtacgcccggctgcggcggtacggtcagtcgc
atcgtccaggcggggcgctcttctttctactgcgcctcctgccaagggtga

DBGET integrated database retrieval system