KEGG   Rhizobium tropici: RTCIAT899_CH02205Help
Entry
RTCIAT899_CH02205 CDS       T02432                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rtr  Rhizobium tropici
Pathway
rtr00071  Fatty acid degradation
rtr00280  Valine, leucine and isoleucine degradation
rtr00281  Geraniol degradation
rtr00310  Lysine degradation
rtr00360  Phenylalanine metabolism
rtr00362  Benzoate degradation
rtr00380  Tryptophan metabolism
rtr00410  beta-Alanine metabolism
rtr00627  Aminobenzoate degradation
rtr00640  Propanoate metabolism
rtr00650  Butanoate metabolism
rtr00903  Limonene and pinene degradation
rtr00930  Caprolactam degradation
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01212  Fatty acid metabolism
Module
rtr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RTCIAT899_CH02205
   00650 Butanoate metabolism
    RTCIAT899_CH02205
  Lipid metabolism
   00071 Fatty acid degradation
    RTCIAT899_CH02205
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RTCIAT899_CH02205
   00310 Lysine degradation
    RTCIAT899_CH02205
   00360 Phenylalanine metabolism
    RTCIAT899_CH02205
   00380 Tryptophan metabolism
    RTCIAT899_CH02205
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RTCIAT899_CH02205
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RTCIAT899_CH02205
   00281 Geraniol degradation
    RTCIAT899_CH02205
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RTCIAT899_CH02205
   00627 Aminobenzoate degradation
    RTCIAT899_CH02205
   00930 Caprolactam degradation
    RTCIAT899_CH02205
Enzymes [BR:rtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RTCIAT899_CH02205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AGB69858
UniProt: L0LEM9
Position
449742..450515
Genome map
AA seq 257 aa AA seqDB search
MAYETLIVETHGAVGLVRINRPQALNALNSTVLSELKQAYAALHLDDAIGAIVLTGSEKA
FAAGADIKEMQSLDFVDAYKNDFFSGWAEIANARKPVIAAVSGFALGGGCEVAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAVEAERSGLVARVV
PADKLLDEALAAAAKIASYSGPAVMMAKEAVNRAFETTLEEGLRFERRLFHSLFATEDQK
EGMAAFVEKRKPAFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggcttacgaaaccctcattgtcgaaacacatggggccgtcggcctcgtccggatcaat
cggccgcaggcgctgaacgcgctgaactcaacggtcctctccgagctgaagcaagcctat
gccgctcttcatcttgacgatgccatcggtgcgatcgtgctcaccggttcggaaaaggcc
ttcgctgccggcgccgacatcaaggaaatgcaatcgctcgatttcgttgacgcctataag
aatgactttttcagcggctgggccgagattgccaatgcccgcaagcctgtcatcgcggcg
gtcagcggctttgcgctcggcggcggctgcgaagtggcgatgatgtgcgatttcatcatc
gcctcggaaaccgccaaattcggccagccggaaatcacgctcggcgtcatccctggcatg
ggcggctcgcagcgtctcacgcgtgcggtcggcaaggccaaggcgatggacctcatattg
acgggccggatgatggatgcggtagaggcggagcgttccggccttgtggcgcgcgtcgta
ccggcagacaagctgctcgacgaggcgctggccgccgccgccaagatcgcttcttattcc
ggtcccgccgtgatgatggccaaggaggcggtcaatcgtgccttcgaaaccacgctcgag
gagggactgcgcttcgaacgccgcctgttccatagcctgttcgccacagaggatcagaag
gagggcatggcggccttcgtcgagaagcgcaagccagccttcaagaaccggtag

DBGET integrated database retrieval system