KEGG   Rhizobium tropici: RTCIAT899_CH03200Help
Entry
RTCIAT899_CH03200 CDS       T02432                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rtr  Rhizobium tropici
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rtr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rtr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654771..655814
Genome map
AA seq 347 aa AA seqDB search
MNALARVLVVDDSPTMRGLITAVLRADPEVDVIGQAGDALEARAAIKALNPDVVTLDIEM
PNMNGLEFLEKIMTLRPMPVIMVSTMTHRGADATLAALEIGAFDCVGKPSPGEPHPFGDL
ADKVKAAARSQRQYVKPAAQRVPPPAVADFRVGRKIVAIGSSTGGVEALINVLQKFPANC
PPTVITQHMPPTFTRSFAERLNRLCAPVVQEATDGARLEIGKIYLAPGGERHLRVANASA
PHCRLVDGGPVNGHRPSVDVLFDSVAELAGRNAVGVILTGMGRDGAAGLLKMRHAGARTI
GQNEKTCVVYGMPRVAHELGAVEQQFPLNAIGEEILKATAARKEGSE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctcgtgttcttgtcgtcgatgactccccgaccatgcggggtctcatc
accgccgtcctgcgtgccgatccagaggtcgacgtcatcggccaggccggtgacgcactg
gaggcgcgcgccgccatcaaggcgctcaatccggatgtcgttaccctcgatatcgagatg
ccgaacatgaacggcctcgaattcctggaaaagatcatgacgcttaggccgatgcccgtc
atcatggtctccacgatgacgcatcgcggcgcggatgcgacgcttgccgcactcgaaatc
ggtgccttcgactgtgtcggaaagccgtctccaggcgagccgcatcctttcggcgatctg
gcggataaggtgaaggcggctgcccgctcgcagcgtcaatacgtgaagcctgccgcccag
cgcgtgccgccgccggccgtcgcggacttccgtgtggggcgtaagatcgtcgccatcggt
tcttccacgggcggcgtcgaggccctgatcaatgtactgcagaaattcccggccaattgt
ccgcccaccgtcatcacgcagcatatgccgccgacctttacgcgcagcttcgccgagcgg
ctgaatcgcctctgtgcgccggtcgtccaggaggcgaccgacggtgcgcggctggaaatc
ggcaagatctatctggcgcctggcggtgagaggcaccttagggtcgccaatgcgtccgcg
cctcattgtcgtctggtagacggcgggccggtgaacggccatcgtccttccgtcgacgtg
ctctttgactcggttgccgaactggccggccgcaatgccgtcggcgtgatcctgaccggg
atggggcgcgacggcgccgccggtctcctcaagatgcgccacgcgggtgcgcgcaccatc
ggccagaacgagaagacctgcgtggtctacggcatgccgagggtcgcccacgagcttggt
gcagtcgaacagcagtttccgctgaacgccattggcgaggaaattttgaaagccacagcc
gcccgaaaggaagggagcgaataa

DBGET integrated database retrieval system