KEGG   Rhizobium tropici: RTCIAT899_CH03945Help
Entry
RTCIAT899_CH03945 CDS       T02432                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
rtr  Rhizobium tropici
Brite
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     RTCIAT899_CH03945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
809589..810296
Genome map
AA seq 235 aa AA seqDB search
MADLSSFPITKRWPASNPDIIQLYSLPTPNGVKVSIALEELGLPYEPHLISFGTNDQKSP
EFVSLNPNGRIPAIIDPNGPDGKPIGLFESGAILVYLAEKTGKLIPSDAARRYETLEWVF
FQMAGVGPMFGQFGHFFKFAAEKVANNSYPVERYRDEAKRLLGVLESRLQGREWIMGDEY
TIADITTFPWVRGVDVFYGGREVLEFESFPSVMAWLDRALARPASQRGLSIPKRD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctgtcgtcctttccgatcacgaagcgctggcccgccagcaatccggatatt
atccagctctattcgctgccaacgccgaacggcgtaaaggtctcgattgcgctggaggag
cttggcctgccctatgagccgcatctgatttccttcggcaccaatgatcagaaatcgccg
gaattcgtttcgctgaacccgaatggccgcattccggcaatcatcgatcccaatggccct
gacggcaaaccgatcggcctgttcgaatccggcgcgatcctggtctatctggcggaaaag
accggcaagctcattccaagcgatgctgccaggcgctacgagacccttgaatgggtcttc
ttccagatggcaggcgtcggtcccatgttcggccagttcggtcatttcttcaaattcgcc
gccgagaaggtcgccaataactcctatccggtcgagcgttatcgcgatgaggccaagcgc
ctcctcggcgtgttggagagccgcctgcagggacgcgaatggatcatgggcgatgaatac
accatcgccgacatcaccacttttccctgggttcgcggcgtcgacgtcttctatggcggc
cgcgaggtgctggagttcgaaagcttcccctccgtcatggcctggctggatcgcgctctg
gcacgtccggcaagccagcgcggcctcagcattcccaagcgggattga

DBGET integrated database retrieval system