KEGG   Rhizobium tropici: RTCIAT899_CH04710Help
Entry
RTCIAT899_CH04710 CDS       T02432                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rtr  Rhizobium tropici
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RTCIAT899_CH04710 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RTCIAT899_CH04710 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RTCIAT899_CH04710 (thrC)
Enzymes [BR:rtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RTCIAT899_CH04710 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(968012..969409)
Genome map
AA seq 465 aa AA seqDB search
MDYISTRGEAPALGFCDALLAGLARDGGLYVPREWPVLTKKEIRAFRGKSYQDVAFAVLS
PFTNGEIPADVFRGMIDDAYATFRHPAVAPLVQTGANSFVMELFHGTTLAFKDVAMQLLA
RLMDYALEKRGQRATIVGATSGDTGGAAIDAFAGRERTDIFILFPHEKVSPVQQRQMTTS
TAANVHALAIKGNFDDCQNLVKAMFNDAAFRDRVKLSGVNSINWARIMAQVVYYFTTAVA
LGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIEKLVIATNENDILARMLKTGRYEMRSV
KATTSPSMDIQISSNFERLLFEANGRDASKVRAAMESLKQSNGFSVSEEALKFIKKDFRA
GRASEKQVAETIRKTLADTGYLLDPHTAIGVFIANKNERPSSPMVTLATAHPAKFPAAVK
SASGIDPALPTWLAGLMTREERFDILDPELKAVESFIGKHIRTGE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtggactacatttcaacgcggggagaagcccctgcccttggcttctgcgacgccctcctg
gccggcctcgctcgtgatggcgggctttatgttccccgtgaatggcctgtcctgacgaag
aaggaaatccgtgcgttccgcggcaagagctatcaggatgtcgccttcgccgtcctttcg
cccttcaccaacggcgaaatcccggccgatgtctttcgcggcatgatcgatgatgcctat
gccaccttccggcatccggccgtggcgccgctcgtccagacgggagcgaacagcttcgtc
atggagcttttccatggcacgacgctcgccttcaaggatgtcgccatgcagctgctggcg
cggctgatggactatgcgctggagaagcgcggccagcgagccaccatcgtcggcgcgacc
tcgggtgataccggcggtgcggcgatcgacgcctttgccgggcgcgagcgcaccgatatc
ttcattctcttcccgcatgagaaagtctcgccggtgcagcagcggcagatgaccacctcg
accgcggcaaatgtgcatgcgctggccatcaagggcaatttcgacgactgccagaacctc
gtcaaagccatgttcaacgacgcagccttccgcgacagggtcaagctttccggcgtcaat
tccatcaactgggcgcgaatcatggcgcaggtggtttactacttcacgacagctgtcgcc
cttggcggtccggaccggaaaatctcgttcaccgtaccaacaggcaatttcggtgatatt
ttcgccggttatgtcgccaagcgcatgggcctgccgatcgaaaagcttgttatcgccacc
aacgagaacgatatcctggcacgcatgctgaagaccggccgctatgagatgcgctcggtc
aaggccacgacttcgccatcgatggatatccagatctcctccaacttcgagcggcttctg
ttcgaagcgaacggccgagacgcctccaaggtgcgtgccgccatggaaagcctgaagcag
tcgaacggattttcggtcagcgaagaggctctgaagttcatcaagaaggacttccgcgcc
ggccgcgccagcgagaagcaggtggccgaaacgatccgcaaaacccttgccgatacgggc
tatctgctcgatccgcacacggcgatcggcgtcttcattgcgaacaagaacgagcgtccc
agcagcccgatggtgacactggcgaccgcccacccggcaaaattccctgccgcagtaaaa
tccgcatccggtattgacccggcgcttccgacgtggcttgctggtctgatgaccagggag
gagcgtttcgacattctcgatccggaacttaaagccgtcgaaagctttatcggcaagcat
atccggaccggcgaatag

DBGET integrated database retrieval system