KEGG   Rhizobium tropici: RTCIAT899_CH06195Help
Entry
RTCIAT899_CH06195 CDS       T02432                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rtr  Rhizobium tropici
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RTCIAT899_CH06195
   00240 Pyrimidine metabolism
    RTCIAT899_CH06195
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RTCIAT899_CH06195
   03430 Mismatch repair
    RTCIAT899_CH06195
   03440 Homologous recombination
    RTCIAT899_CH06195
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RTCIAT899_CH06195
DNA replication proteins [BR:rtr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RTCIAT899_CH06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1266666..1267115
Genome map
AA seq 149 aa AA seqDB search
MTDVLFYHLTESKLEDALPPLIDKSVERGWQVAVQMREPARRDLLDSHLWTYREDSFLPH
GTEEGDMADKQPVLLTISSENINNASVRFFIDGAEATDVGTYQRVVLMFDGYDQEQLESA
RAQWKRLKGEGHNLTYWQQTQDGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgttctcttctatcatctgacggaatcgaagcttgaagacgccctgccgccg
ctgatcgacaagagcgtcgaacgtggctggcaggtcgccgtgcagatgcgcgagccggcc
cggcgcgatctcctcgatagccatctatggacctatcgcgaggacagctttctaccgcat
ggcacggaggaaggcgacatggcagacaagcagccggtgctgctgaccatttcctctgag
aacataaataatgcctcggtgcgtttcttcatcgacggggccgaggcaacggatgttggg
acctatcagcgcgtcgtgctgatgttcgacggctacgatcaggaacagttggaaagcgcg
cgtgcccaatggaagcgcctgaaaggcgagggacataacctcacctactggcagcagacg
caggacggccgctgggagaagaaggcctga

DBGET integrated database retrieval system