KEGG   Rhizobium tropici: RTCIAT899_CH07905Help
Entry
RTCIAT899_CH07905 CDS       T02432                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rtr  Rhizobium tropici
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rtr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rtr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1613451..1614566
Genome map
AA seq 371 aa AA seqDB search
MASIGSPFSFGARCSCASPLDVTRISRRKPYDSDMTESKSMILGCSGHTITPEERSFYQG
EQPWGFILFGRNISEPAQIADLVASLRDSVGRDAPVFIDQEGGRVQRIRPPILQHYPSGQ
ALGDIYRQDRERGRRAAWLMSRLHAFDLLKFGINVDCLPVLDVPVEGSSNVIGNRAYGSD
PGTVTEMGRAAAEGLKAGGVLPVMKHMPGHGRGFADSHHELPVVSVPRAELEAHDFAPFV
ALKHELMAMTCHVVFTDIDPENPATTSRKVNEEIIRGYIGFQGLLLSDDTSMNALKGTIG
ERAANIVAGGCDIVLHCNGVMDEMQQVVRNVPALAGASLARAKAVEAAFGRNDGADEASI
RAEFDAIFAVA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcatcggctcgccgttttcgtttggagcgcgctgttcctgtgcatctccgctt
gacgtcactcgcatttcccggcgcaagccttatgattcggatatgaccgaatcgaaatcc
atgatcctcggctgtagcggccacaccatcacccccgaagagcgatccttttatcaaggg
gagcagccctggggctttatcctgttcggacgcaatatttccgagccggcgcagatcgcc
gatctcgttgcgtctcttcgtgatagcgtcgggcgcgatgcaccggttttcatcgatcag
gaaggcggcagggtgcagcgcatccgtccaccgatcctgcaacattatccctcggggcag
gcactcggcgatatctatcgtcaggatcgcgaacgaggccgacgcgccgcatggctgatg
tcgcggctccacgccttcgatttgctgaagttcggtatcaatgtcgattgtctgccggtg
ctcgacgtgcctgtggagggatcgagcaacgtcatcggcaatcgcgcctatggctccgat
ccggggacggtgacggagatggggcgtgccgccgcggaaggtctgaaagccggcggcgtg
ctgcccgtgatgaagcatatgcccggccacggccgcggctttgccgattcgcatcacgag
ctacccgtcgtctcggttccgcgcgcagaactggaggcgcatgatttcgcgcctttcgtg
gctctcaagcatgagctgatggcgatgacgtgccacgtcgtcttcaccgatatcgatccg
gagaatccggccacgacgtcgcgcaaggtgaacgaggagatcatccgcggctatatcggt
ttccaggggctgctcctgtcggacgatacctcgatgaatgcgctgaagggcacgatcggc
gagcgcgcagcaaatattgttgcgggcggatgcgatatcgtgctgcactgcaatggcgtc
atggacgagatgcagcaggtggttcgcaatgttcccgcgctggcgggtgcatcgctggca
agggccaaggcggtcgaagcggctttcggcagaaatgatggtgccgatgaagcctccatt
cgggcggaattcgacgcgatcttcgccgtagcgtag

DBGET integrated database retrieval system