KEGG   Rhizobium tropici: RTCIAT899_CH08605Help
Entry
RTCIAT899_CH08605 CDS       T02432                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rtr  Rhizobium tropici
Pathway
rtr00010  Glycolysis / Gluconeogenesis
rtr00020  Citrate cycle (TCA cycle)
rtr00620  Pyruvate metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
Module
rtr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RTCIAT899_CH08605
   00020 Citrate cycle (TCA cycle)
    RTCIAT899_CH08605
   00620 Pyruvate metabolism
    RTCIAT899_CH08605
Enzymes [BR:rtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RTCIAT899_CH08605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Ribosomal_60s DUF2118 QRPTase_N GCV_H ATP-synt_ab_Xtn Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AGB71109
UniProt: L0LM00
Position
1739723..1741078
Genome map
AA seq 451 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKIKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVIAADGEDVAAAASGAGAAAAPAAKEAPKAEAAPAAAPASIAAPA
AAAPAPAASAPAANDGHRTFASPLARRLAKEAGIDVTAVSGTGPHGRVVKKDIEAAVSGG
TAKAAPAAAPAAQPAAAAAPAAAKGMSDDAVLKLFEQGSYELVPHDGMRKTIAKRLQESK
QTIPHFYVSVDCELDALLALRTQLNDSAPKSKDGVPAYKLSVNDMVIKALALALRDVPDA
NVSWTDSAMVKHKHADVGVAVSIPGGLITPIIRSAEQKTLSTISNEMKDYGKRAKERKLK
PEEYQGGTTAVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVIVKKGEMVIANVMTVTL
STDHRAVDGALGAELLAAFKGYIENPMGMLV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcaacatcactatgcctgccctctcgccgaccatggaagagggtaacctcgcc
aagtggctggtcaaggaaggcgacaagatcaagtccggcgatgtcatcgccgagatcgag
actgacaaggcaacgatggaagtcgaggctgtcgatgagggcacggtcgccaagatcgtc
gttcccgccggcactgaaggcgtgaaggtcaatgccctgatcgccgtgatcgctgccgat
ggcgaggatgtcgctgctgcagcatcaggcgctggtgccgctgctgctccggcagccaag
gaagctccgaaggcggaagcagcccctgcggccgctccggcaagcattgcggctcctgcc
gcagcagccccggctccggctgcatcggctcctgccgcaaacgacggtcatcgcaccttt
gcttcgccgctcgcacgccgtcttgccaaggaagccggcatcgatgtgactgcagtctcc
ggcaccggcccgcatggccgcgtggtcaagaaggatatcgaagctgccgtttccggcggc
accgccaaggccgctcctgcagcagcaccggctgcacagccggccgcggctgctgctccg
gccgctgcgaagggcatgtccgacgacgccgtgctcaagctgttcgagcagggttcctac
gagctcgtgccgcatgacggcatgcgcaagacgattgcaaagcgcctgcaggaatccaag
cagacgatcccgcacttctacgtttcggtcgattgcgaactcgacgcgctgctggcgctc
cgcacgcagctcaacgattccgctccgaagtcgaaggacggcgtcccggcctacaagctc
tcggtcaatgacatggtcatcaaggccctggcgctggcattgcgcgatgttccggatgcc
aatgtctcctggaccgacagcgccatggtcaagcacaagcatgccgatgtcggcgtcgcc
gtctccattccgggcggcctgattaccccgatcatccgcagcgccgagcagaagacgctc
tccaccatctccaacgagatgaaggactacggcaagcgcgccaaggagcgcaagctgaag
cccgaggagtatcagggcggcaccaccgcagtgtcgaacatgggcatgatgggcgtgaag
aacttcgccgccgtcgtcaacccgccgcatgcgaccatcctggccgtcggcgcgggcgag
cagcgcgtcatcgtcaagaagggcgaaatggtgattgccaacgtgatgaccgtcacgctg
tcgaccgaccaccgcgccgtcgacggtgcgctcggcgccgagctcctggcagccttcaag
ggctacatcgaaaatccgatggggatgctcgtctga

DBGET integrated database retrieval system