KEGG   Rhizobium tropici: RTCIAT899_CH10210Help
Entry
RTCIAT899_CH10210 CDS       T02432                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
rtr  Rhizobium tropici
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2069375..2070442
Genome map
AA seq 355 aa AA seqDB search
MSTAIAPKAQIPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPTLTRELAALGKNAT
QEELDAIGAKYFPHHAARVFDEAHTRLASELDAVLRALRQEQTTLESYNRLLGETSESIS
SRSHNSAELLRSAIDMLATATGDTMAHGEKTVEHVVERSQEMDLVRKELDEYKRIANTDS
LTRLSNRRAFEDRLICIFDNQLTRPTTALVLADIDHFKRVNDTFGHPVGDKILATVASII
RANVRRDVFVARVGGEEFALILEATSIEEVTTVCERIRRTLEATPFKNSRTRVDYGPITL
SLGICMASEAADSGELYNKADLALYCAKNAGRNCSSVYQDGMQKDFTKSWLIYKN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcgattgcgccgaaggcgcagattcccgacgtggcagggcaaattacctac
gccatgcgatccatgggggtcgcacctattccgcgcaattacgaacttttctacgaagct
tatatcggctccaatcccactcttacgcgtgaactggcagctctgggcaaaaacgccacc
caggaggagctggacgcgatcggcgccaagtattttccgcatcatgcggctcgtgtcttc
gatgaagcgcatacccgcctcgcctccgaactcgatgccgtcctgcgcgccctgcgtcag
gaacagacaacactcgaaagctataaccgcctgctcggcgaaaccagtgaaagcataagc
tccagaagccacaacagcgccgaactgctgcgtagcgccattgacatgctcgccacagca
acaggcgatacgatggctcacggtgaaaagaccgtcgagcatgtcgtggagcgcagccag
gaaatggatctggtccgcaaggagctggacgaatacaagcgcatcgccaacaccgattcg
ctaacccggctttccaaccgccgcgccttcgaggaccggctgatctgcatcttcgacaac
cagcttacccggccgacgaccgctctggttcttgccgatatcgatcacttcaagcgagtc
aacgacacgttcggccacccggtcggcgacaagattctcgccaccgtcgcctccatcatc
cgcgccaatgtacgtcgcgacgttttcgtcgcccgcgtcggaggcgaggaattcgctctc
attctggaagccaccagcatcgaggaagtcacgacggtttgcgagcggatccgtcgcacc
ctggaggcgacgccgttcaagaattcgcgcacgagagttgactatggtccgatcaccctc
tccctcggcatctgtatggcttcggaagcagccgattccggggaactatataacaaggcc
gatctggcgctttactgcgccaagaatgccggccgcaattgcagcagcgtctatcaagat
ggcatgcagaaggatttcaccaaaagttggctcatctacaagaattag

DBGET integrated database retrieval system