KEGG   Rhizobium tropici: RTCIAT899_CH10210Help
Entry
RTCIAT899_CH10210 CDS       T02432                                 

Definition
(GenBank) GGDEF domain-containing protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rtr  Rhizobium tropici
Brite
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     RTCIAT899_CH10210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2069375..2070442
Genome map
AA seq 355 aa AA seqDB search
MSTAIAPKAQIPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPTLTRELAALGKNAT
QEELDAIGAKYFPHHAARVFDEAHTRLASELDAVLRALRQEQTTLESYNRLLGETSESIS
SRSHNSAELLRSAIDMLATATGDTMAHGEKTVEHVVERSQEMDLVRKELDEYKRIANTDS
LTRLSNRRAFEDRLICIFDNQLTRPTTALVLADIDHFKRVNDTFGHPVGDKILATVASII
RANVRRDVFVARVGGEEFALILEATSIEEVTTVCERIRRTLEATPFKNSRTRVDYGPITL
SLGICMASEAADSGELYNKADLALYCAKNAGRNCSSVYQDGMQKDFTKSWLIYKN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcgattgcgccgaaggcgcagattcccgacgtggcagggcaaattacctac
gccatgcgatccatgggggtcgcacctattccgcgcaattacgaacttttctacgaagct
tatatcggctccaatcccactcttacgcgtgaactggcagctctgggcaaaaacgccacc
caggaggagctggacgcgatcggcgccaagtattttccgcatcatgcggctcgtgtcttc
gatgaagcgcatacccgcctcgcctccgaactcgatgccgtcctgcgcgccctgcgtcag
gaacagacaacactcgaaagctataaccgcctgctcggcgaaaccagtgaaagcataagc
tccagaagccacaacagcgccgaactgctgcgtagcgccattgacatgctcgccacagca
acaggcgatacgatggctcacggtgaaaagaccgtcgagcatgtcgtggagcgcagccag
gaaatggatctggtccgcaaggagctggacgaatacaagcgcatcgccaacaccgattcg
ctaacccggctttccaaccgccgcgccttcgaggaccggctgatctgcatcttcgacaac
cagcttacccggccgacgaccgctctggttcttgccgatatcgatcacttcaagcgagtc
aacgacacgttcggccacccggtcggcgacaagattctcgccaccgtcgcctccatcatc
cgcgccaatgtacgtcgcgacgttttcgtcgcccgcgtcggaggcgaggaattcgctctc
attctggaagccaccagcatcgaggaagtcacgacggtttgcgagcggatccgtcgcacc
ctggaggcgacgccgttcaagaattcgcgcacgagagttgactatggtccgatcaccctc
tccctcggcatctgtatggcttcggaagcagccgattccggggaactatataacaaggcc
gatctggcgctttactgcgccaagaatgccggccgcaattgcagcagcgtctatcaagat
ggcatgcagaaggatttcaccaaaagttggctcatctacaagaattag

DBGET integrated database retrieval system