KEGG   Rhizobium tropici: RTCIAT899_CH11185Help
Entry
RTCIAT899_CH11185 CDS       T02432                                 

Definition
putative pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rtr  Rhizobium tropici
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RTCIAT899_CH11185
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RTCIAT899_CH11185
    3.5.1.-  
     RTCIAT899_CH11185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2260839..2261462
Genome map
AA seq 207 aa AA seqDB search
MKALLLIDIQTGFCPGGNLPVPGGDEIVPAANELIDSGKYDLIIASQDWHPPGHGSFASS
HPGKKPFEIGMLSGKPQMMWPDHCVQNSEDAGFHPDLHLTSVDFIQQKGQNPAVDSYSAF
RDNDQAALTGLAAYLRSQDVTELDLCGLATDYCVKFSALDAVEMLPGVTVRFIEDASRGI
DPAGVKSAIDEMRARGVAVISSKDALA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctgctgctcatcgatatccagaccggcttctgccctggcggcaatcttcca
gtgcctggaggcgatgagatcgtgcccgctgccaatgagctcatcgacagcggcaaatac
gatctcatcatcgcgtcacaggattggcatccgcctggtcatggcagcttcgcctcctcc
catcccggcaagaaaccctttgaaatcggcatgctctcgggcaagccgcagatgatgtgg
cccgatcactgcgtccagaacagcgaagatgccgggttccatcccgaccttcatctgacc
tccgtcgatttcatccagcagaagggccagaaccccgcagtcgacagctattccgccttc
cgcgacaacgatcaggcagccctgaccggccttgccgcctatctgcgcagtcaggatgtc
accgaactcgatctttgcggcctggcgaccgattactgcgtgaaattctcggcactcgat
gccgttgaaatgctgcctggcgttaccgtccgcttcatcgaagatgcaagccgaggcatc
gatcccgccggcgtcaaatcggcaatcgacgagatgcgagcccgtggtgttgcggtgatc
agcagcaaggatgcgcttgcgtaa

DBGET integrated database retrieval system