KEGG   Rhizobium tropici: RTCIAT899_CH12970Help
Entry
RTCIAT899_CH12970 CDS       T02432                                 

Definition
putative O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rtr  Rhizobium tropici
Brite
Enzymes [BR:rtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RTCIAT899_CH12970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2606073..2606912)
Genome map
AA seq 279 aa AA seqDB search
MTADSRASLDEIRDFHAKMMAAASNSSDERLEQAFRLVRREAFMGPGPWQIVVKGRHLET
PSSDPAFLYQNVLVSLDKSKGINNGEPFLHAAFLGAVAPQPGEAVIQIGTGTGYYTAILS
TLVAPGGHVHAVEVDEALANRTRDNLASFENASVICADATELELPQADLIYVSAGVVAPP
ISWLQALRLGGRIIVPWQANEKVGLAVLITRAKQGFSARALMPAYFIPCIGASDPMQTTK
TPNGGEARSIQSVWLTRDRAPDETAVAIYRDLWFSNAGL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccgacagccgcgcaagtttggatgagatacgggacttccatgcgaagatgatg
gctgctgccagcaattcttcggacgaaaggctggagcaggcctttcgcctcgttcggcgt
gaggccttcatggggccggggccttggcagatcgtggtcaagggacgccatctcgaaacg
ccaagcagtgatcccgcctttctctatcagaatgttttggtctccctggataaatccaag
ggcatcaacaatggcgagccatttctccatgctgccttcttgggcgccgtcgcgccgcag
cccggtgaggcggtcatccagatcggcacgggaactggatattacaccgccattctgtcg
acgctggtggcgccgggcggccacgtccacgccgtcgaggtcgatgaggcattggccaac
cgcacccgcgataatcttgcctcgttcgagaacgcctccgtcatctgcgccgatgcgacc
gagctggagcttccgcaagcggatctgatctacgtgagcgccggggtggtggcgccgccg
atatcgtggctgcaggcgctgcgcctcggcggccggatcatcgtgccctggcaggcgaac
gaaaaggtcgggcttgctgtcctgatcacacgcgcaaagcaggggttcagcgcccgcgcc
ttgatgcccgcctatttcattccctgcatcggagcttccgatcccatgcaaaccacgaaa
acgccaaatggaggcgaggctcgctccatccagtcggtttggctcacccgagatcgagcg
ccggatgaaacggcggttgcgatctatagagacctgtggttttcgaatgcaggtctctga

DBGET integrated database retrieval system