KEGG   Rhizobium tropici: RTCIAT899_CH13005Help
Entry
RTCIAT899_CH13005 CDS       T02432                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
rtr  Rhizobium tropici
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rtr00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rtr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2614340..2614726)
Genome map
AA seq 128 aa AA seqDB search
MKLQCLASAVIVLASTSSVLADGDAVAGAVVFKKCGACHTATGPDNRVGPSLMGIVGRAV
ASKPDYAYSPAMRAFGADGKVWDEALLRKYLPAPQFLVKGTRMSFPGLKNDRDLDNLIAY
LKNPAATQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcaatgtctggcgtcggcggtcatcgtgcttgcctcgacttcttccgtgctc
gcggatggcgatgccgtcgcgggtgccgtcgttttcaagaaatgcggggcatgtcatacg
gcgaccgggccagacaatcgcgtcggcccctcgctgatgggaatcgtcgggcgagccgtc
gcaagcaagccggattacgcctattcgccggcgatgagggcattcggggctgatggcaag
gtctgggatgaagcgctgctgcggaaatatctgccggcgccgcaattcctcgtcaaaggc
acccggatgtccttcccaggtctgaaaaacgacagggacctcgataaccttattgcctat
ttgaagaatcctgccgctacccaatag

DBGET integrated database retrieval system