KEGG   Rhizobium tropici: RTCIAT899_CH13185Help
Entry
RTCIAT899_CH13185 CDS       T02432                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rtr  Rhizobium tropici
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RTCIAT899_CH13185 (glpK)
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RTCIAT899_CH13185 (glpK)
Exosome [BR:rtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RTCIAT899_CH13185 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2649076..2650686)
Genome map
AA seq 536 aa AA seqDB search
MNRKAHISAKNFVLLSFHIRFARVSVASGRNRREECMSGYVLAIDQGTTSTRAIVFDGKM
KVAGVGQKEFTQHYPKPGWVEHDPEEIWSSVLVTVRKAIEAAGITAKDIAALGITNQRET
VIVWDRETGKPIHNAIVWQDRRTASYCEKLKRQDLEKLFTRRTGLLLDPYFSGTKLSWLL
SNVKGARARAAKGELCFGTVDSFLIWRLTGGKSFATDATNASRTLMYNIGANEWDEELLD
ILRVPAAMLPEVKDCAADFGVTDATHFGTEIPILGVAGDQQAATIGQACFERGMMKSTYG
TGCFALLNTGADMVRSKNRLLTTIAYRLNGETTYALEGSIFIAGAAVQWLRDGLKAIQRA
SDSGELAAKADPLQEVYLVPAFTGLGAPHWDPDARGAIFGLTRNTGPEEIVRAALEAVCY
QSRDLLDAMHRDWRNGNGQGTVLRVDGGMVASDWTMQRLADLLDAPVDRPTILETTALGA
AWLAGSRAGVWPDRAGFAKAWARDKRFEPGMDAKTRNAKLKGWKNAVSRTLSTRQG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaggaaagcgcatatttcagcgaaaaatttcgttttgctttcttttcacattcgt
tttgctcgcgtatctgttgcttcgggacgcaacaggcgggaggaatgcatgagcggttat
gtcttggcgatcgatcagggaacgacgtcgacgcgggctatcgttttcgacggcaagatg
aaggttgccggtgtcgggcagaaggaattcacccagcattatccgaagcccggctgggtg
gagcacgatccggaagaaatctggtcctccgtcctcgtcaccgtccgcaaggcgatcgag
gctgccggcatcaccgccaaggatattgccgcactcggcatcaccaaccagcgcgagact
gtgatcgtctgggatcgcgagacgggcaagccaatccacaacgccatcgtctggcaggac
cgccgcacggcgagctattgcgagaaactgaagcgtcaggacctggaaaagctctttacc
cgccgcaccggcctgctgctcgatccctatttttccggcaccaaactgtcctggctcttg
agcaacgtgaagggcgcgcgtgcccgcgccgccaagggcgagctttgcttcggcaccgtc
gatagcttcctgatctggcgtctgactggcggcaagagcttcgctaccgatgcgaccaat
gcctcgcggacgctgatgtataatatcggcgcgaacgaatgggacgaggagctgctcgat
atcctgcgcgttcccgccgccatgctgcctgaagtgaaggattgcgccgccgatttcggc
gtcacggatgccacgcatttcggcaccgaaatcccgatcctcggcgttgccggcgatcag
caggcggcgacgatcggccaggcctgcttcgagcgcggcatgatgaaatccacctatggc
accggctgcttcgcgctgctcaataccggcgcggacatggtgcgctcgaagaaccgcctt
ttgaccaccatcgcctatcgcctgaatggcgagacgacctatgcactcgaaggctcgatc
ttcattgcgggcgccgccgtacaatggctgcgcgatgggctgaaggccatccagcgtgcc
tcggattccggcgagctggcggccaaggccgatccgctgcaggaggtctatctcgtgccg
gccttcaccggtctcggggcaccgcattgggacccggatgcacgcggcgcgatcttcggg
ctgacgcgcaataccggacctgaggaaatcgtccgggcggctctggaggctgtctgttac
cagtctcgcgatctcctggatgccatgcatagggattggcgcaacggcaacgggcaagga
acagtattgcgcgtcgacggtggcatggtcgcctccgactggacgatgcagcggcttgcc
gatctgctggacgcgccggtcgatcgcccgacgatcctcgaaaccacagcgctgggcgcc
gcctggcttgccggcagccgcgccggcgtctggccggatcgtgccggcttcgccaaggcc
tgggcgcgcgataagcgttttgagcccggcatggatgccaagacccgcaacgcgaagctg
aaaggctggaagaacgctgtctcgcgcaccttgagtacacggcaggggtga

DBGET integrated database retrieval system