KEGG   Rhizobium tropici: RTCIAT899_CH13185Help
Entry
RTCIAT899_CH13185 CDS       T02432                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rtr  Rhizobium tropici
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rtr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2649076..2650686)
Genome map
AA seq 536 aa AA seqDB search
MNRKAHISAKNFVLLSFHIRFARVSVASGRNRREECMSGYVLAIDQGTTSTRAIVFDGKM
KVAGVGQKEFTQHYPKPGWVEHDPEEIWSSVLVTVRKAIEAAGITAKDIAALGITNQRET
VIVWDRETGKPIHNAIVWQDRRTASYCEKLKRQDLEKLFTRRTGLLLDPYFSGTKLSWLL
SNVKGARARAAKGELCFGTVDSFLIWRLTGGKSFATDATNASRTLMYNIGANEWDEELLD
ILRVPAAMLPEVKDCAADFGVTDATHFGTEIPILGVAGDQQAATIGQACFERGMMKSTYG
TGCFALLNTGADMVRSKNRLLTTIAYRLNGETTYALEGSIFIAGAAVQWLRDGLKAIQRA
SDSGELAAKADPLQEVYLVPAFTGLGAPHWDPDARGAIFGLTRNTGPEEIVRAALEAVCY
QSRDLLDAMHRDWRNGNGQGTVLRVDGGMVASDWTMQRLADLLDAPVDRPTILETTALGA
AWLAGSRAGVWPDRAGFAKAWARDKRFEPGMDAKTRNAKLKGWKNAVSRTLSTRQG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaggaaagcgcatatttcagcgaaaaatttcgttttgctttcttttcacattcgt
tttgctcgcgtatctgttgcttcgggacgcaacaggcgggaggaatgcatgagcggttat
gtcttggcgatcgatcagggaacgacgtcgacgcgggctatcgttttcgacggcaagatg
aaggttgccggtgtcgggcagaaggaattcacccagcattatccgaagcccggctgggtg
gagcacgatccggaagaaatctggtcctccgtcctcgtcaccgtccgcaaggcgatcgag
gctgccggcatcaccgccaaggatattgccgcactcggcatcaccaaccagcgcgagact
gtgatcgtctgggatcgcgagacgggcaagccaatccacaacgccatcgtctggcaggac
cgccgcacggcgagctattgcgagaaactgaagcgtcaggacctggaaaagctctttacc
cgccgcaccggcctgctgctcgatccctatttttccggcaccaaactgtcctggctcttg
agcaacgtgaagggcgcgcgtgcccgcgccgccaagggcgagctttgcttcggcaccgtc
gatagcttcctgatctggcgtctgactggcggcaagagcttcgctaccgatgcgaccaat
gcctcgcggacgctgatgtataatatcggcgcgaacgaatgggacgaggagctgctcgat
atcctgcgcgttcccgccgccatgctgcctgaagtgaaggattgcgccgccgatttcggc
gtcacggatgccacgcatttcggcaccgaaatcccgatcctcggcgttgccggcgatcag
caggcggcgacgatcggccaggcctgcttcgagcgcggcatgatgaaatccacctatggc
accggctgcttcgcgctgctcaataccggcgcggacatggtgcgctcgaagaaccgcctt
ttgaccaccatcgcctatcgcctgaatggcgagacgacctatgcactcgaaggctcgatc
ttcattgcgggcgccgccgtacaatggctgcgcgatgggctgaaggccatccagcgtgcc
tcggattccggcgagctggcggccaaggccgatccgctgcaggaggtctatctcgtgccg
gccttcaccggtctcggggcaccgcattgggacccggatgcacgcggcgcgatcttcggg
ctgacgcgcaataccggacctgaggaaatcgtccgggcggctctggaggctgtctgttac
cagtctcgcgatctcctggatgccatgcatagggattggcgcaacggcaacgggcaagga
acagtattgcgcgtcgacggtggcatggtcgcctccgactggacgatgcagcggcttgcc
gatctgctggacgcgccggtcgatcgcccgacgatcctcgaaaccacagcgctgggcgcc
gcctggcttgccggcagccgcgccggcgtctggccggatcgtgccggcttcgccaaggcc
tgggcgcgcgataagcgttttgagcccggcatggatgccaagacccgcaacgcgaagctg
aaaggctggaagaacgctgtctcgcgcaccttgagtacacggcaggggtga

DBGET integrated database retrieval system