KEGG   Rhizobium tropici: RTCIAT899_CH14660Help
Entry
RTCIAT899_CH14660 CDS       T02432                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rtr  Rhizobium tropici
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rtr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2950193..2950807)
Genome map
AA seq 204 aa AA seqDB search
MIGKLKGTIEEIGEDYVLVDVHGVCYVAYCSARTLSKLGSVGEACILFIETYVREDQIRL
FGFMTALEREWFNIVQTVQGVGAKVALALLSTLTPAELANAIALQDRAAVSRAPGVGPKV
AMRIVTELKNKAPAFAGDAANIALKQELGEGVAAAPVADAVSALTNLGYSRDQAANAIAA
AMKAAGEGADSAKLIRLGLKELAR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctgaaaggcacaatcgaagagatcggcgaggactatgtgctcgtggat
gtgcacggcgtctgctacgtcgcctattgttcggctcggacgctgtcgaagctcggttcg
gttggcgaggcctgtattcttttcatcgagacctatgttcgtgaagaccagatccggctc
ttcggcttcatgacggcgctggagcgcgaatggttcaacatcgtgcagacggttcagggt
gtcggtgcgaaggtggcgctggcgctgctgtcgacgctgacgcccgccgagcttgccaat
gcgatcgccctgcaggatcgcgccgccgtctcgcgggcgccgggtgtcggccccaaggtc
gccatgcgcatcgtgacggaactgaagaacaaggcgccggcttttgccggcgacgcggcc
aatatcgcgctcaagcaggaactgggcgaaggcgttgctgcagcacccgtggccgatgcc
gtttcggcgctgaccaatctcggctattcccgcgatcaggcggccaatgccatcgccgcg
gcgatgaaggcggccggcgagggcgccgatagcgccaagctgatccggctcggcctcaag
gaactcgcgcggtga

DBGET integrated database retrieval system