KEGG   Rhizobium tropici: RTCIAT899_CH15205Help
Entry
RTCIAT899_CH15205 CDS       T02432                                 

Definition
lysophospholipase L2 protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rtr  Rhizobium tropici
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RTCIAT899_CH15205
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RTCIAT899_CH15205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3058200..3059174
Genome map
AA seq 324 aa AA seqDB search
MDSILYSTADNPVPENRTEGFFESFDGRKLRYAVFRCEQPVAKGTVVLLQGRNEFIEKYS
ETIRDLAAKGLWVATFDLRGQGGSERLLKDPLRGHIRHFSDYERDLTAFLDKIVLPDTRL
PFFLLAHSTGGLIALSAAPRLATRIERMVLSAPFIGLTGHGASPGFIRFLSGAVSGIGLG
RMQFSKKFKERPFAENPLTTDEQRYRRNIGIGATYPQLCLGPPTARWLSQALRAIERVNR
PEHLFSIQIPTVLIAPTRDGVVPYADQERLSRYFRAAQLVPVHGAKHEILQERDVYRNQA
LAAIHAFIPGSDAETNAYEIEAEA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggattcgatcctctattccacagcagataatccggtgccggaaaaccgcaccgaaggc
ttcttcgaaagtttcgacggccgcaagctgcgctatgccgtcttccgctgcgagcagccg
gtcgccaagggaaccgttgtgctgctgcagggccgtaacgaattcatcgagaaatattcc
gagacgatccgcgacctcgcagccaagggcctttgggtcgcgaccttcgatctgcgtggc
cagggcggatccgagcggctgctgaaagacccgttgcgcggccacatccgccatttttcc
gattatgagcgggatctgactgccttcctcgacaagatcgtcctgccggatacgcgtctg
cccttctttctcctcgcccattcgacgggcggtctgattgccctgtccgcggcgccgagg
cttgcgacacgaattgagcgcatggtgctgtctgctccgttcatcggccttaccggccat
ggcgcctctcctggctttatccgctttctgtccggcgcggtcagcggtatcggccttggc
cgcatgcagttcagcaagaagttcaaggaaaggccatttgctgaaaacccgctgacgacg
gacgagcagcgctaccgccgcaacatcggcatcggcgccacctatccgcagctttgcctg
ggaccgccgacggcacgctggctgtcgcaggccttgcgggcaatcgaacgggtcaacagg
cccgaacatctgttttcgatccagattccgaccgtcctgatcgcgccgacgcgcgacggg
gtcgtgccttatgccgatcaggagcggctgtcgcgctatttccgcgccgcacagctggtg
cctgtccacggcgccaagcatgaaatcctgcaggaacgggatgtctatcgcaatcaggca
cttgccgcgatccacgccttcatccccggcagcgatgccgagaccaatgcctatgaaatt
gaggcagaagcctga

DBGET integrated database retrieval system