KEGG   Rhizobium tropici: RTCIAT899_CH15450Help
Entry
RTCIAT899_CH15450 CDS       T02432                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rtr  Rhizobium tropici
Brite
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RTCIAT899_CH15450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3117110..3118486
Genome map
AA seq 458 aa AA seqDB search
MPLTYRRLLPLLALAGLSLTGAAVGMASEPATSASATDDYDDQAPLSAVAQLGKKLFFDP
SLSGGGQMSCATCHDPANHYAPANGLAVQLGGLHLDQPGIRAVPSLAYKMSTPSFSIGEE
SAADEAAEASPMTEASGVALANAPAVTSPLTAQAVVKADAAAANLVPQGGMFWDGRVDSL
EEQALQPMISPFEMANADVATVYTKVTKGYGKDISALFGDNILNDQDMTISEIGFALARY
QIEDRSFHPYTSKYDYYLRGKAVLTDAEARGLKLFDDANKGNCASCHLDKMTGDGQMPNF
TDFEFEALGAPRNPTIPANADAHYFDTGICGPLRSDAYSAQQQNCGLFKTPTLRNVATRH
VFFHNGVYRTLEDVTRFYVKRDTNPEEIYPKDASGKVLKYDDLPAQYRANIDVSDAPMNR
KPGDAPALNDAEIADIVAFLKTLTDGYDPTKDNVKAAK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgacctaccgccgtctcctgccgctcctcgcactcgcgggcctgtcgctcacg
ggtgcggctgtcggcatggcaagcgaaccggcgaccagtgcttcggcgaccgacgactat
gacgaccaggcgccgctcagcgcggtggcgcagctcggcaaaaagctgttcttcgatccc
tcgctctcgggcggcggccagatgtcttgcgccacgtgccatgatccggccaaccactat
gcgccggccaacggtcttgccgtgcagctcggcggcttgcaccttgaccagcccggcatc
cgcgccgtgcccagcctcgcctacaagatgtcgaccccatccttctcgatcggcgaggaa
agtgctgccgacgaagctgcggaagcctcgccgatgacggaggcctccggcgtggctctg
gccaatgcccccgccgtcaccagtccgctgacggcacaggccgtcgtcaaggccgatgca
gcagcggccaatctcgtgccgcagggcggcatgttctgggatggacgtgtcgattcgctg
gaagaacaagccctgcagccgatgatctcgcccttcgaaatggcgaatgccgatgtggcc
accgtctataccaaggtgacgaagggatacggcaaggatatttcggcgctcttcggcgac
aatatcctcaacgatcaggacatgacgatctccgagatcggcttcgcgcttgcccgctac
cagatcgaggatcgctccttccacccatatacgagcaaatacgattattatctgcgcggc
aaggcagtcctgacggatgcggaagcgcggggtctgaagctcttcgacgatgcgaacaag
ggcaattgtgcctcctgtcatctcgacaagatgaccggcgatgggcagatgcctaacttc
accgatttcgaattcgaggcgctcggcgcaccgcgcaatccgacgattccggccaatgcc
gatgcgcattatttcgacaccggcatttgcggcccgttgcgcagcgacgcctattccgcc
caacagcagaattgcgggctgttcaagacgccgacgctgcgcaatgtcgctacccgccac
gttttcttccacaatggcgtctaccgcacactggaggatgtcacccgcttctacgtcaag
cgcgataccaatccggaggagatctatccgaaggatgcgagcggcaaggtgctgaaatat
gatgatctgccggcgcagtatcgggcaaatatcgatgtcagcgacgcgccgatgaaccgc
aagcccggcgatgcccctgccctgaacgatgccgagatcgccgatatcgtcgccttcctg
aaaacgctgacggatggatacgacccgacgaaggacaacgtgaaggcagccaaataa

DBGET integrated database retrieval system