KEGG   Rhizobium tropici: RTCIAT899_CH16615Help
Entry
RTCIAT899_CH16615 CDS       T02432                                 

Gene name
rocF
Definition
putative arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rtr  Rhizobium tropici
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rtr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rtr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3360574..3361509
Genome map
AA seq 311 aa AA seqDB search
MNTQSTPVTLIGVPLEEGSGRRGAGMGPTALRIAGIETTLTELGHRVTDSGDLHPVPAAD
LPDHPHAHNLKIVGAFTRALEAKVYDVASSGGFPLILGGDHSLSMGSVSGMARHAAEVGR
PLFVLWLDAHSDFNSPATSPSGNIHGMPVAFFCGEAEIEGVLPAGRSLVDPTKVFQVGIR
SVDPREREEIREHGVNVFDMRSLDEQGVAAIMRKVLDTVGEANGLLHVSFDVDFLDPDIA
PGVGTTVPGGATYREAHLIMEMLSDSNLVSSLDLVELNPFLDDRGKSARVLVEMAASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcaatccactcccgttactctgatcggcgttcccctggaagaaggatccggt
cgccgcggcgccggcatgggtccgacggcgctccgcatcgccggcatcgaaaccacgctg
accgaacttggccatcgcgtcacggatagcggcgacctgcatcctgttccagcagccgac
ctgcccgaccatccccacgctcacaatctgaagatcgtcggcgcgttcacgcgtgcactg
gaagcaaaggtctatgatgtcgcatcgtccggtggcttcccgctaatcctgggtggcgac
cacagcctctccatgggcagcgtctccggcatggcccgccacgcggcggaagttggtcgc
cccctcttcgtgctctggcttgacgctcactccgatttcaattcccccgctacctcgccc
tcaggcaatattcacggcatgcccgttgcattcttctgcggtgaagccgagatcgagggc
gttctgccggccggccggtcgctggtcgatccgacgaaggtcttccaggtcggtatccgc
tccgtcgatccgcgtgaacgtgaggaaatccgcgaacacggcgtcaacgtcttcgacatg
cgctccctcgacgagcaaggcgtcgccgccatcatgcgcaaggtgctcgataccgtcggc
gaggccaacggcctgctgcatgtcagcttcgatgtcgatttcctcgatccggatatcgca
ccgggtgtcggaaccaccgtgccgggcggcgccacctatcgcgaagcgcatctcatcatg
gaaatgctctccgacagcaatcttgtctcgtccctcgatctcgtcgagctcaaccccttc
ctcgacgatcgcggcaagagcgcccgtgttcttgtggaaatggcggcaagcctcttcggc
cggcgcatcttcgaccgccccacacgagcggcttaa

DBGET integrated database retrieval system