KEGG   Rhizobium tropici: RTCIAT899_CH16615Help
Entry
RTCIAT899_CH16615 CDS       T02432                                 

Gene name
rocF
Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rtr  Rhizobium tropici
Pathway
rtr00220  Arginine biosynthesis
rtr00330  Arginine and proline metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01130  Biosynthesis of antibiotics
rtr01230  Biosynthesis of amino acids
Module
rtr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RTCIAT899_CH16615 (rocF)
   00330 Arginine and proline metabolism
    RTCIAT899_CH16615 (rocF)
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RTCIAT899_CH16615 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGB72686
UniProt: L0LPQ0
Position
3360574..3361509
Genome map
AA seq 311 aa AA seqDB search
MNTQSTPVTLIGVPLEEGSGRRGAGMGPTALRIAGIETTLTELGHRVTDSGDLHPVPAAD
LPDHPHAHNLKIVGAFTRALEAKVYDVASSGGFPLILGGDHSLSMGSVSGMARHAAEVGR
PLFVLWLDAHSDFNSPATSPSGNIHGMPVAFFCGEAEIEGVLPAGRSLVDPTKVFQVGIR
SVDPREREEIREHGVNVFDMRSLDEQGVAAIMRKVLDTVGEANGLLHVSFDVDFLDPDIA
PGVGTTVPGGATYREAHLIMEMLSDSNLVSSLDLVELNPFLDDRGKSARVLVEMAASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcaatccactcccgttactctgatcggcgttcccctggaagaaggatccggt
cgccgcggcgccggcatgggtccgacggcgctccgcatcgccggcatcgaaaccacgctg
accgaacttggccatcgcgtcacggatagcggcgacctgcatcctgttccagcagccgac
ctgcccgaccatccccacgctcacaatctgaagatcgtcggcgcgttcacgcgtgcactg
gaagcaaaggtctatgatgtcgcatcgtccggtggcttcccgctaatcctgggtggcgac
cacagcctctccatgggcagcgtctccggcatggcccgccacgcggcggaagttggtcgc
cccctcttcgtgctctggcttgacgctcactccgatttcaattcccccgctacctcgccc
tcaggcaatattcacggcatgcccgttgcattcttctgcggtgaagccgagatcgagggc
gttctgccggccggccggtcgctggtcgatccgacgaaggtcttccaggtcggtatccgc
tccgtcgatccgcgtgaacgtgaggaaatccgcgaacacggcgtcaacgtcttcgacatg
cgctccctcgacgagcaaggcgtcgccgccatcatgcgcaaggtgctcgataccgtcggc
gaggccaacggcctgctgcatgtcagcttcgatgtcgatttcctcgatccggatatcgca
ccgggtgtcggaaccaccgtgccgggcggcgccacctatcgcgaagcgcatctcatcatg
gaaatgctctccgacagcaatcttgtctcgtccctcgatctcgtcgagctcaaccccttc
ctcgacgatcgcggcaagagcgcccgtgttcttgtggaaatggcggcaagcctcttcggc
cggcgcatcttcgaccgccccacacgagcggcttaa

DBGET integrated database retrieval system