KEGG   Rhizobium tropici: RTCIAT899_CH16820Help
Entry
RTCIAT899_CH16820 CDS       T02432                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rtr  Rhizobium tropici
Pathway
rtr00020  Citrate cycle (TCA cycle)
rtr00310  Lysine degradation
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
Module
rtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTCIAT899_CH16820 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RTCIAT899_CH16820 (sucB)
Enzymes [BR:rtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RTCIAT899_CH16820 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AGB72727
UniProt: L0LN99
Position
complement(3407643..3408884)
Genome map
AA seq 413 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPLLELETDKVTIEVPAPSAGTLSEIV
AQAGETVGLGALLGQISAGNGAAAAPAQAAAPAAAAPAPAAAAPVAAPAASAPASSMPPA
PAAGKLLAENNLSADQVEGSGKRGQVLKGDVIAAVAKAASAPAAAPATPVAARAPTAVED
VSREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDVFEKKHGVKL
GFMGFFTKAVTHALKELPAVNAEIDGTDIIYKNYCHVGMAVGTDKGLVVPVIRDADQMSI
AEVEKELGRLAKAARDGTLAMADMQGGTFTITNGGVYGSLMSSPILNAPQSGILGMHKIQ
ERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaatccgcgttcctaccctcggcgaatccgtcagcgaggcgaccgtcggt
acctggttcaagaaggtcggcgatgccatcaaggccgatgagccgcttctcgaactcgaa
accgacaaggtgacgatcgaagttccggcgccctccgccggtacgctttccgaaatcgtt
gcccaggccggcgaaaccgtaggtctcggcgcgctgctcggccagatctccgccggcaac
ggcgctgcagccgctccggcacaggctgctgcacccgccgccgctgctccggctcctgcc
gctgctgcaccggttgccgctcccgccgcttccgctccggcttcctccatgccgccggca
ccggctgccggtaagctccttgccgaaaacaatctctctgccgatcaggtcgaaggcagc
ggcaagcgcggccaggtcctgaagggtgatgtcattgctgccgtcgccaaggctgcttcg
gctcccgccgctgcaccggcaacacccgttgccgctcgcgctccgaccgccgtcgaggac
gtcagccgcgaagagcgcgtcaagatgacccgcctgcgccagacgatcgccaagcgcctc
aaggatgcgcagaacaccgccgccatgctcaccacctataacgaggtggacatgaaggcc
gtcatggacctgcgcaacaagtacaaggacgtcttcgagaagaagcatggcgtgaagctc
ggcttcatgggcttcttcaccaaagccgtcacccacgcgctgaaggaactgcctgctgtc
aacgccgagatcgacggcaccgacatcatctacaagaactactgccacgtcggcatggct
gtcggcaccgacaagggtcttgtcgttcccgtgatccgcgatgcagatcagatgtcgatc
gccgaagtcgagaaggaacttggccgcctggcgaaggctgctcgcgacggcacactggcg
atggccgacatgcagggcggcaccttcaccatcaccaatggcggcgtctacggttcgctg
atgtcctcgccgatcctgaatgcgccgcagtcgggcattctcggcatgcacaagatccag
gaacgcccggttgccatcggcggtcaggtcgtcatccgaccgatgatgtatctggcgctt
tcctacgatcaccgtatcgtcgacggcaaggaagccgtgaccttcctcgtccgcgtcaag
gaaagcctggaagatccggaacgtctcgttctcgatctctaa

DBGET integrated database retrieval system