KEGG   Rhizobium tropici: RTCIAT899_CH16840Help
Entry
RTCIAT899_CH16840 CDS       T02432                                 

Definition
succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rtr  Rhizobium tropici
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RTCIAT899_CH16840
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTCIAT899_CH16840
   00640 Propanoate metabolism
    RTCIAT899_CH16840
   00660 C5-Branched dibasic acid metabolism
    RTCIAT899_CH16840
Enzymes [BR:rtr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RTCIAT899_CH16840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3413703..3414896)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLKSYGAPVADGVAIFSADEAAAAAKQLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAKSIDDVVANAKDMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYL
SILVDRSVGQVAFVVSTEGGMDIETVAHDTPEKIITVAIDPSTGVTAANTAALSDALKLE
GAAREDAAKLFPILYKAFVEKDMALLEVNPLIVMTNGRLRVLDAKVSFDGNALFRHEDVR
ALRDTSEEDEKEIQAHEYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTAAFKIITADPAVQGILVNIFGGIMKCDVIAEGVLAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaataccaggccaaggcgctgttgaagagctatggcgcacccgtcgcg
gacggcgttgccatcttctccgccgatgaagccgctgccgccgccaagcagctcccaggc
ccgctctacgtcgtcaagagccagatccatgctggcggccgcggcaagggcaagttcaag
gaactcggccccgacgccaagggcggcgttcgtctcgccaagtccattgacgacgtggtc
gccaacgccaaggacatgctcggcaacacgctggtgaccaagcagaccggcccggctggc
aagcaggtcaaccgcctctacatcgaagacggcgcggacatcgaccgcgaactctacctc
tcgatcctggtcgaccgctccgtcggtcaggtcgctttcgtcgtttcgaccgaaggcggc
atggacatcgagaccgttgcgcacgacacgccggaaaagatcatcaccgtcgccatcgac
ccgtcgacgggtgtgacggctgccaatacggctgctctttccgacgcgctgaagctcgag
ggtgctgcccgcgaagatgccgccaagctcttcccgatcctctacaaggccttcgtcgag
aaggacatggcgctcctcgaagtcaacccgctgatcgtcatgaccaacggtcgcctgcgc
gttctcgacgccaaggtttccttcgacggcaacgctctcttccgtcacgaagacgtccgc
gcgctccgcgacacgtccgaagaagacgagaaggaaatccaggcgcatgaatacgacctc
gcctatgtcgccctcgacggcaacatcggctgcatggtcaatggcgccggccttgccatg
gcaaccatggacatcatcaagctctacggcgctgagccggcgaacttcctcgatgtcggc
ggtggcgccaccaaggaaaaggttacggccgccttcaagatcatcactgccgatccggct
gtccagggcattctggtcaacatcttcggcggcatcatgaagtgcgacgtcattgccgaa
ggcgtgctcgcagccgtcaaggaagtcggtctgaaggttccgctcgtcgttcgcctcgaa
ggcaccaatgtcgagctcggcaagaagatcatcaacgaatccggtctcaacgtcatctcc
gcagatgacctggacgatgccgcccagaagatcgtgaaggcagtcaagggctga

DBGET integrated database retrieval system