KEGG   Rhizobium tropici: RTCIAT899_CH16920Help
Entry
RTCIAT899_CH16920 CDS       T02432                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rtr  Rhizobium tropici
Pathway
rtr00860  Porphyrin and chlorophyll metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RTCIAT899_CH16920 (hemD)
Enzymes [BR:rtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RTCIAT899_CH16920 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGB72747
UniProt: L0LNB7
Position
3427570..3428298
Genome map
AA seq 242 aa AA seqDB search
MRVVVTRPRHSGERTMRRLTQMGHEPLLLPLAEPVHHVEEARRALLTTQGVVAVTSAEAF
RVLAALGSDIEPHLGRPLFAVGKATAREAAELGFSNIAVSEGAGAELAALVSRHSAGRNA
APLLYLAGFPRAAGFEAGLAELHLPFLTVECYRMQDIIPDDVTLRRFFSDARADAVLLYS
HETARRFFSLSFVGHYMELFAETRFLCLSEAVAGAVPETLQSHVDIADMPNEDRLLALLI
RA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgtcgtcacccgccctcggcattcgggtgaacgcaccatgcggcggctgacg
caaatggggcatgaacccctgctgctgccgctggccgaacccgtccatcatgtcgaggag
gcaagacgagcgctcctgaccacgcagggcgtcgtcgccgtcaccagcgccgaggcgttc
cgcgtgctggcggcgctaggctccgatatcgagccccatctcggacgaccgctctttgcg
gtgggcaaggcaacggctagagaggcggcggagctcggcttcagcaatatcgcagtctcc
gaaggcgccggcgccgagcttgccgccctggtttcacgccattctgccggcaggaatgcc
gcgcccctcctctatctcgctggctttccgcgcgcggccggtttcgaagccggattggcg
gagctgcacctgcctttcctgaccgtcgaatgctaccgaatgcaggatatcatccccgac
gacgtcactcttcgccggtttttttccgacgctcgcgcggatgccgtgctgctttattcc
cacgaaaccgccaggcgctttttcagcctttctttcgtcggccactacatggagcttttt
gcggaaacgcggtttctttgtttgagcgaagccgtcgcgggcgcggttccggagacgctg
caatcccatgtcgatatcgccgacatgccgaatgaagaccgacttctggcgcttctgatc
cgggcgtaa

DBGET integrated database retrieval system