KEGG   Rhizobium tropici: RTCIAT899_CH16920Help
Entry
RTCIAT899_CH16920 CDS       T02432                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rtr  Rhizobium tropici
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rtr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3427570..3428298
Genome map
AA seq 242 aa AA seqDB search
MRVVVTRPRHSGERTMRRLTQMGHEPLLLPLAEPVHHVEEARRALLTTQGVVAVTSAEAF
RVLAALGSDIEPHLGRPLFAVGKATAREAAELGFSNIAVSEGAGAELAALVSRHSAGRNA
APLLYLAGFPRAAGFEAGLAELHLPFLTVECYRMQDIIPDDVTLRRFFSDARADAVLLYS
HETARRFFSLSFVGHYMELFAETRFLCLSEAVAGAVPETLQSHVDIADMPNEDRLLALLI
RA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgtcgtcacccgccctcggcattcgggtgaacgcaccatgcggcggctgacg
caaatggggcatgaacccctgctgctgccgctggccgaacccgtccatcatgtcgaggag
gcaagacgagcgctcctgaccacgcagggcgtcgtcgccgtcaccagcgccgaggcgttc
cgcgtgctggcggcgctaggctccgatatcgagccccatctcggacgaccgctctttgcg
gtgggcaaggcaacggctagagaggcggcggagctcggcttcagcaatatcgcagtctcc
gaaggcgccggcgccgagcttgccgccctggtttcacgccattctgccggcaggaatgcc
gcgcccctcctctatctcgctggctttccgcgcgcggccggtttcgaagccggattggcg
gagctgcacctgcctttcctgaccgtcgaatgctaccgaatgcaggatatcatccccgac
gacgtcactcttcgccggtttttttccgacgctcgcgcggatgccgtgctgctttattcc
cacgaaaccgccaggcgctttttcagcctttctttcgtcggccactacatggagcttttt
gcggaaacgcggtttctttgtttgagcgaagccgtcgcgggcgcggttccggagacgctg
caatcccatgtcgatatcgccgacatgccgaatgaagaccgacttctggcgcttctgatc
cgggcgtaa

DBGET integrated database retrieval system