KEGG   Rhizobium tropici: RTCIAT899_CH16980Help
Entry
RTCIAT899_CH16980 CDS       T02432                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rtr  Rhizobium tropici
Pathway
rtr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RTCIAT899_CH16980
Enzymes [BR:rtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RTCIAT899_CH16980
Transporters [BR:rtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   RTCIAT899_CH16980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 GST_C_5 Tom37 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AGB72759
UniProt: L0LRJ4
Position
complement(3438807..3439490)
Genome map
AA seq 227 aa AA seqDB search
MSDAKLVLVSHYLCPYVQRAAITLAEKAVPFEVRYVDLSAKPDWFLAISPLGKVPLLIVR
QDDGVETVLFESAVICEYLEETQSGARLHPADPLARARHRGWMEFGSSILSDLWGFETAK
DEGTYGAKRKALIEKFTRVEAELRNGPFFAGEAFSLVDAVFAPIFRYFDVFDTITSTGVF
DGLPRVKAWRTELASRQSVRDAVTHDYPERLKAFLVNHDAFLLKHAA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcaaaactggtgcttgtcagccattacctttgcccctacgtccagcgagcc
gccatcacgcttgctgaaaaggccgtgccatttgaggtccgctatgtcgatctatcggca
aagcccgactggtttcttgcgatttctccgcttggcaaagtgcctctcctgatcgtgcgg
caggacgatggagtggaaacggttttgttcgagagcgccgtgatctgcgaatatctcgag
gaaacccaatccggtgctcggctccacccggccgatccgctggcgcgcgcccgccatcgc
ggctggatggagttcggttcttccatcctttcggacttgtggggattcgagaccgccaag
gacgaaggaacctatggggccaagcgcaaagcgctgatcgaaaaatttactcgggtcgag
gcggaattgagaaacggtcccttttttgccggagaggcgttcagcctggtcgatgcagtt
tttgcgccgatcttccgttacttcgatgtgttcgacaccatcacatcgacgggcgttttc
gacgggctcccgcgtgtcaaggcatggcgcacggagttggcgtcgcggcaaagcgtgcga
gacgcggtgacgcacgactatccggagcgcctcaaagctttcctggtcaatcatgacgcg
ttcttactgaagcatgctgcttga

DBGET integrated database retrieval system