KEGG   Rhizobium tropici: RTCIAT899_CH17055Help
Entry
RTCIAT899_CH17055 CDS       T02432                                 

Definition
putative esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rtr  Rhizobium tropici
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rtr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3451390..3452085)
Genome map
AA seq 231 aa AA seqDB search
MAGATGPSSEFREWIMGFKVAALQFAVITFGLLFGAVHSVNARTIQLVGFGDSLMAGYQL
PPGDGFPAKLEAALKAKGLDIAVADAGVSGDTTSGGLSRIDWSVPDGTDGVILELGANDA
LRGIPPEQTEKNLETMIERLKGRKIPIFLVGMLAPPNMGGDYADKFNPIYKRLADKYQLS
LYPFFLDGVATHADLQLSDGMHPNPKGVDVMVEHMLPDVMSFVGMIDAGAK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgactggcccgagcagcgaatttagggaatggatcatgggttttaaagtt
gccgcgcttcaattcgctgtcatcactttcggtcttttgtttggcgcggttcactctgtc
aatgcacggacgatccagctggtcggcttcggtgacagcctgatggcgggctatcagctg
ccgccgggcgacggatttcccgcgaagcttgaggcggcgctgaaggccaagggactcgat
atcgccgtcgccgatgccggtgtttcgggcgatacgacttcaggcggcctctcgcgcatc
gactggtcggtgcctgatggcactgatggcgtcattctggagcttggcgccaacgacgcg
ctgcgcggcatcccgccggagcagaccgaaaagaacctcgagacgatgatcgagcgattg
aagggcaggaagatcccgatcttcttggtcggcatgctggcgccgccgaacatgggtggt
gactacgccgataaattcaacccgatctacaagcggctggccgacaaataccagctttcg
ctctatccgttcttcctcgatggcgttgccacccatgcggatctgcagctgtcggacggg
atgcatccgaaccctaagggggtcgatgtgatggtcgagcatatgttgcctgatgttatg
agttttgtagggatgattgatgcaggtgcgaaatag

DBGET integrated database retrieval system