KEGG   Rhizobium tropici: RTCIAT899_PC00570Help
Entry
RTCIAT899_PC00570 CDS       T02432                                 

Definition
L-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rtr  Rhizobium tropici
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RTCIAT899_PC00570
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RTCIAT899_PC00570
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RTCIAT899_PC00570
Enzymes [BR:rtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RTCIAT899_PC00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:125554..126681
Genome map
AA seq 375 aa AA seqDB search
MSKATYVDPITGRTYPLEIPRWCSDEQTPLLITPQVGISRDEIERDIRSLWRYRASLPIR
IEAPISLGEGCTPLVQGHWEDFRPYFKLEWFNPTLSFKDRGTTVMLSAMRQLGVDAVLED
SSGNGGASVAAYGAAGGMRVKIFAPSYTSPAKIAQVGAYGAEVELVDGPREESQAMAIRQ
SKEVFYCSHNWQPFFLQGTKSFAYELWEDFNFSVPDNIVAPAGAGSTLLGCYIGFQELKA
AGQIDKLPRLFAAQPFNCSPIDASFKAGVDDPVERGVRKTLAEGTAIREPLRLRQLVDAL
RQTGGSTVAVSEQDIIATLKKLGRAGLLAEPTSATAAAALDHLIRDKMISERENTVVILT
GTGIKSAQVIAEIFE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaagcgacttatgttgatccaatcacgggtcgtacctatccattggaaattccg
cggtggtgctcggacgaacaaacgccgcttctgatcacgcctcaagttggtatctcccgc
gatgagattgaacgcgacatccggtctctttggcgctatcgggcgtcgctccctattagg
atcgaagcgccgatctcgttgggcgaaggctgcacgccacttgttcaaggccattgggaa
gattttcgtccttacttcaagctcgaatggttcaacccgaccttaagcttcaaagatcgt
ggaacaacggtgatgctgtctgcgatgaggcaattgggggtcgacgctgttctcgaagac
agttccgggaatggcggcgcgtctgtcgcagcctatggcgcggcgggaggaatgcgcgtg
aaaatctttgccccctcctacacatcacctgcaaaaatcgcgcaagtcggagcctatggc
gcggaagtcgagctcgttgacggcccacgtgaggaatcgcaggcgatggcgatccgtcag
tcgaaggaggttttttactgcagccataactggcagccgttcttcctccagggaacgaag
tcctttgcctatgagctgtgggaagacttcaacttctcggttccggacaatatcgtcgcg
ccggccggtgcgggaagcacgctgcttggatgctacatcggcttccaggaattgaaggcg
gcgggacaaatcgacaagcttcctcgtctgttcgctgctcaaccttttaactgctccccg
atcgatgcaagcttcaaggctggtgttgacgaccctgtcgaacggggggtcagaaagaca
cttgccgaaggaacagcaattcgggagccgcttcgtttgcggcagcttgtcgatgctctt
cgccagacaggcggctccaccgttgcggtctccgagcaagacatcatcgcaacattgaag
aagcttggaagggctggactccttgccgagccgacatcggcgactgctgctgccgctctt
gaccacctcattcgagacaaaatgatcagtgaacgtgaaaatactgtggtgattttgacg
ggaactggcataaaaagtgcgcaagtcattgcggaaattttcgaatga

DBGET integrated database retrieval system