KEGG   Rhizobium tropici: RTCIAT899_PC01890Help
Entry
RTCIAT899_PC01890 CDS       T02432                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rtr  Rhizobium tropici
Pathway
rtr00010  Glycolysis / Gluconeogenesis
rtr00052  Galactose metabolism
rtr00500  Starch and sucrose metabolism
rtr00520  Amino sugar and nucleotide sugar metabolism
rtr00521  Streptomycin biosynthesis
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
Module
rtr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RTCIAT899_PC01890
   00052 Galactose metabolism
    RTCIAT899_PC01890
   00500 Starch and sucrose metabolism
    RTCIAT899_PC01890
   00520 Amino sugar and nucleotide sugar metabolism
    RTCIAT899_PC01890
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RTCIAT899_PC01890
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RTCIAT899_PC01890
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RTCIAT899_PC01890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AGB74181
UniProt: L0LU00
Position
pRtrCIAT899c:complement(413429..414400)
Genome map
AA seq 323 aa AA seqDB search
MKRVALAFDLGGTELRAALIDDAGSLLSFSSLSTDAAGGPAAVIRQIEQLAETVLAETPG
LSPIGIGIGAPGPLDPDAGVVIAAPTLVGWHEVPLADILHGHFRLPVRLENDANAAALGE
WRYGAGRGAESMVFVTVSTGIGGGVIADGRILHGRRGLAAEIGHMTITNEGERCFCGAIG
CFEAVASGTALGRRATARTRPSDGTMLRKLAADADVTGRHVVEAAREGDADALALLTDEA
RLLGIGFTNLLHLYSPDLLVMGGGISHGFDLLHDQMVMTVRERAMPAYRDVPIVAAQLGR
HAGLIGAASLIFDDEGNSLTKLN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagggtcgctcttgcattcgatctcggtggaacggagcttcgtgccgcgcttatc
gatgatgcgggaagccttctgtcgttctcgtcgctatcgacggacgcagccggcggcccc
gcggccgtgatccgccagatcgaacagctggccgaaacggtgctggcggagacacccggt
ctttcgccgatcgggatcgggatcggtgcgcccggtccactcgacccggacgccggtgtc
gtcattgccgccccgacgctcgtcggatggcatgaggttccgttggcggacattctccac
ggccacttccggctgcccgtgcggcttgaaaacgatgcaaacgcggcagcgctcggcgaa
tggcgatatggcgccggccgcggggcggaatcgatggtgttcgtcacggtatcgaccggt
atcggcggcggcgtgattgccgatggccggatcctgcacggaagacggggtctggctgcc
gagatcggccacatgacgatcacgaacgagggcgagcgttgcttttgtggcgcaatcggc
tgcttcgaagccgtcgcctccggtacggcgctcggcaggcgtgcaacggcccgcaccagg
ccgtcagacggaacgatgctgcgcaagctcgccgccgacgccgatgtaaccggacgacac
gttgttgaagctgcgcgagagggcgacgctgatgcattggcgctgctgactgacgaggcg
cgcttgctggggatcggctttacgaacctgcttcacctctattcgcccgacctgcttgtc
atgggcggaggaatttcgcatggcttcgatcttctgcacgatcaaatggtgatgacagtt
cgcgagcgcgccatgcccgcctatcgcgacgtgccgatcgttgccgcgcagctcgggcgc
catgccggcttgatcggcgcggccagcctcatcttcgacgacgagggaaactcgcttacc
aaactgaattga

DBGET integrated database retrieval system